data_1P8B # _entry.id 1P8B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1P8B RCSB RCSB019133 WWPDB D_1000019133 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1P8B _pdbx_database_status.recvd_initial_deposition_date 2003-05-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jouvensal, L.' 1 ? 'Quillien, L.' 2 ? 'Ferrasson, E.' 3 ? 'Rahbe, Y.' 4 ? 'Gueguen, J.' 5 ? 'Vovelle, F.' 6 ? # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI _citation.pdbx_database_id_patent primary 'PA1b, an insecticidal protein extracted from pea seeds (Pisum sativum): 1H-2-D NMR study and molecular modeling' Biochemistry 42 11915 11923 2003 BICHAW US 0006-2960 0033 ? 14556622 10.1021/bi034803l ? 1 ;Characterization of a high affinity binding site for the pea albumin 1b entomotoxin in the weevil Sitophilus ; EUR.J.BIOCHEM. 270 2429 2435 2003 EJBCAI IX 0014-2956 0262 ? ? 10.1046/j.1432-1033.2003.03611.x ? 2 'Use of a polypeptide derived from a PA1b legume albumen as insecticide' Patent ? ? ? 1999 ? ? ? ? ? ? ? PCT/FR99/01085 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jouvensal, L.' 1 ? primary 'Quillien, L.' 2 ? primary 'Ferrasson, E.' 3 ? primary 'Rahbe, Y.' 4 ? primary 'Gueguen, J.' 5 ? primary 'Vovelle, F.' 6 ? 1 'Gressent, F.' 7 ? 1 'Rahioui, I.' 8 ? 1 'Rahbe, Y.' 9 ? 2 'Delobel, B.' 10 ? 2 'Grenier, A.M.' 11 ? 2 'Gueguen, J.' 12 ? 2 'Ferrasson, E.' 13 ? 2 'Mbaiguinam, M.' 14 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Pea Albumin 1, subunit b' _entity.formula_weight 3749.391 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PA1b, Albumin A1b, Leginsulin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ASCNGVCSPFEMPPCGTSACRCIPVGLVIGYCRNPSG _entity_poly.pdbx_seq_one_letter_code_can ASCNGVCSPFEMPPCGTSACRCIPVGLVIGYCRNPSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 CYS n 1 4 ASN n 1 5 GLY n 1 6 VAL n 1 7 CYS n 1 8 SER n 1 9 PRO n 1 10 PHE n 1 11 GLU n 1 12 MET n 1 13 PRO n 1 14 PRO n 1 15 CYS n 1 16 GLY n 1 17 THR n 1 18 SER n 1 19 ALA n 1 20 CYS n 1 21 ARG n 1 22 CYS n 1 23 ILE n 1 24 PRO n 1 25 VAL n 1 26 GLY n 1 27 LEU n 1 28 VAL n 1 29 ILE n 1 30 GLY n 1 31 TYR n 1 32 CYS n 1 33 ARG n 1 34 ASN n 1 35 PRO n 1 36 SER n 1 37 GLY n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name pea _entity_src_nat.pdbx_organism_scientific 'Pisum sativum' _entity_src_nat.pdbx_ncbi_taxonomy_id 3888 _entity_src_nat.genus Pisum _entity_src_nat.species ? _entity_src_nat.strain 'cv. Frilene' _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details 'isolated from pea seeds' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ALB1B_PEA _struct_ref.pdbx_db_accession P62927 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ASCNGVCSPFEMPPCGTSACRCIPVGLVVGYCRNPSG _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1P8B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62927 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 63 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 37 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1P8B _struct_ref_seq_dif.mon_id ILE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 29 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P62927 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 55 _struct_ref_seq_dif.details 'SEE REMARK 999' _struct_ref_seq_dif.pdbx_auth_seq_num 29 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 DQF-COSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2.1mM PA1b; 0.02% NaN3; 50% H2O, 50% TFE-d2' _pdbx_nmr_sample_details.solvent_system '50% H20, 50% TFE-d2' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1P8B _pdbx_nmr_refine.method 'Torsion angle simulated annealing, molecular dynamics in explicit solvent' _pdbx_nmr_refine.details ;The structures are based on 858 NOE-derived distance restraints, 15 dihedral angle restraints and 7 hydrogen bond restraints ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1P8B _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1P8B _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1P8B _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.1 processing Delaglio 1 XEASY 6001 'data analysis' Bartels 2 CNS 1.1 'structure solution' Brunger 3 ARIA 1.1 'structure solution' Linge 4 ARIA 1.1 refinement Linge 5 # _exptl.entry_id 1P8B _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1P8B _struct.title 'SOLUTION STRUCTURE OF PA1B, A 37-AMINO ACID INSECTICIDAL PROTEIN EXTRACTED FROM PEA SEEDS (PISUM SATIVUM)' _struct.pdbx_descriptor 'Albumin 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1P8B _struct_keywords.pdbx_keywords 'PLANT PROTEIN' _struct_keywords.text 'inhibitor cystine-knot, PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 17 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 17 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 3 A CYS 20 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 7 A CYS 22 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 15 A CYS 32 1_555 ? ? ? ? ? ? ? 2.026 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 1 -0.23 2 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 2 -0.34 3 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 3 -0.39 4 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 4 -0.22 5 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 5 -0.31 6 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 6 -0.39 7 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 7 -0.14 8 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 8 -0.18 9 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 9 -0.23 10 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 10 -0.28 11 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 11 -0.37 12 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 12 -0.28 13 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 13 0.08 14 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 14 -0.16 15 MET 12 A . ? MET 12 A PRO 13 A ? PRO 13 A 15 -0.20 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 4 ? CYS A 7 ? ASN A 4 CYS A 7 A 2 GLY A 30 ? ARG A 33 ? GLY A 30 ARG A 33 A 3 ARG A 21 ? ILE A 23 ? ARG A 21 ILE A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 7 ? N CYS A 7 O GLY A 30 ? O GLY A 30 A 2 3 O TYR A 31 ? O TYR A 31 N ILE A 23 ? N ILE A 23 # _database_PDB_matrix.entry_id 1P8B _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1P8B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLY 37 37 37 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-11-25 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-02-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_abbrev' 2 4 'Structure model' '_citation.pdbx_database_id_patent' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 4 ? ? -173.47 134.36 2 1 VAL A 25 ? ? -84.34 44.79 3 1 PRO A 35 ? ? -76.19 32.58 4 2 ASN A 4 ? ? -170.31 132.02 5 2 VAL A 25 ? ? -86.88 39.24 6 2 PRO A 35 ? ? -70.41 30.96 7 3 PRO A 14 ? ? -58.00 -74.04 8 3 VAL A 25 ? ? -83.77 36.74 9 3 SER A 36 ? ? -151.06 -41.94 10 4 ASN A 4 ? ? -173.26 134.32 11 5 ASN A 4 ? ? -174.61 126.86 12 5 THR A 17 ? ? -179.95 139.38 13 5 VAL A 25 ? ? -85.07 38.32 14 5 PRO A 35 ? ? -75.65 33.51 15 6 CYS A 7 ? ? -140.36 -155.85 16 6 CYS A 15 ? ? 78.32 -39.03 17 6 VAL A 25 ? ? -84.71 36.29 18 6 PRO A 35 ? ? -67.57 23.64 19 7 SER A 2 ? ? -67.80 73.92 20 7 SER A 18 ? ? 72.83 -42.42 21 7 PRO A 35 ? ? -81.14 37.80 22 8 VAL A 25 ? ? -81.57 32.53 23 8 SER A 36 ? ? -151.85 49.01 24 9 ASN A 4 ? ? 179.69 117.76 25 9 VAL A 25 ? ? -85.72 36.68 26 9 SER A 36 ? ? -92.39 -69.61 27 10 SER A 2 ? ? -158.84 58.36 28 10 PRO A 14 ? ? -50.98 -80.99 29 10 VAL A 25 ? ? -80.92 36.61 30 11 THR A 17 ? ? -143.84 -39.77 31 11 SER A 18 ? ? 72.03 -39.14 32 12 PRO A 35 ? ? -68.16 30.29 33 13 ASN A 4 ? ? -171.64 135.85 34 13 CYS A 15 ? ? 59.35 13.19 35 13 THR A 17 ? ? -141.89 -31.06 36 13 SER A 18 ? ? 70.07 -41.03 37 13 VAL A 25 ? ? -82.59 38.10 38 13 PRO A 35 ? ? -68.31 1.98 39 14 ASN A 4 ? ? -173.77 148.79 40 14 THR A 17 ? ? -172.05 140.84 41 15 ASN A 4 ? ? -175.53 38.96 42 15 PRO A 35 ? ? -73.23 41.90 43 15 SER A 36 ? ? -150.79 27.72 #