data_1PCN # _entry.id 1PCN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1PCN WWPDB D_1000175604 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1PCO _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PCN _pdbx_database_status.recvd_initial_deposition_date 1994-06-08 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Breg, J.N.' 1 'Sarda, L.' 2 'Cozzone, P.J.' 3 'Rugani, N.' 4 'Boelens, R.' 5 'Kaptein, R.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of porcine pancreatic procolipase as determined from 1H homonuclear two-dimensional and three-dimensional NMR.' Eur.J.Biochem. 227 663 672 1995 EJBCAI IX 0014-2956 0262 ? 7867624 10.1111/j.1432-1033.1995.tb20186.x 1 ;A Protein Fold Element Comprising a Triple-Strand B-Sheet and Two Disulphide Bridges Recognized in Procolipase and Other Unrelated Proteins ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Breg, J.N.' 1 primary 'Sarda, L.' 2 primary 'Cozzone, P.J.' 3 primary 'Rugani, N.' 4 primary 'Boelens, R.' 5 primary 'Kaptein, R.' 6 1 'Breg, J.N.' 7 1 'Ujah, E.C.' 8 1 'Sarda, L.' 9 1 'Cozzone, P.J.' 10 1 'Kaptein, R.' 11 # _cell.entry_id 1PCN _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PCN _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PORCINE PANCREATIC PROCOLIPASE B' 10117.486 1 ? ? ? ? 2 non-polymer syn 'HYDROXIDE ION' 17.007 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSIT NTNFGICHNVGRS ; _entity_poly.pdbx_seq_one_letter_code_can ;VPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSIT NTNFGICHNVGRS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 PRO n 1 3 ASP n 1 4 PRO n 1 5 ARG n 1 6 GLY n 1 7 ILE n 1 8 ILE n 1 9 ILE n 1 10 ASN n 1 11 LEU n 1 12 ASP n 1 13 GLU n 1 14 GLY n 1 15 GLU n 1 16 LEU n 1 17 CYS n 1 18 LEU n 1 19 ASN n 1 20 SER n 1 21 ALA n 1 22 GLN n 1 23 CYS n 1 24 LYS n 1 25 SER n 1 26 ASN n 1 27 CYS n 1 28 CYS n 1 29 GLN n 1 30 HIS n 1 31 ASP n 1 32 THR n 1 33 ILE n 1 34 LEU n 1 35 SER n 1 36 LEU n 1 37 SER n 1 38 ARG n 1 39 CYS n 1 40 ALA n 1 41 LEU n 1 42 LYS n 1 43 ALA n 1 44 ARG n 1 45 GLU n 1 46 ASN n 1 47 SER n 1 48 GLU n 1 49 CYS n 1 50 SER n 1 51 ALA n 1 52 PHE n 1 53 THR n 1 54 LEU n 1 55 TYR n 1 56 GLY n 1 57 VAL n 1 58 TYR n 1 59 TYR n 1 60 LYS n 1 61 CYS n 1 62 PRO n 1 63 CYS n 1 64 GLU n 1 65 ARG n 1 66 GLY n 1 67 LEU n 1 68 THR n 1 69 CYS n 1 70 GLU n 1 71 GLY n 1 72 ASP n 1 73 LYS n 1 74 SER n 1 75 LEU n 1 76 VAL n 1 77 GLY n 1 78 SER n 1 79 ILE n 1 80 THR n 1 81 ASN n 1 82 THR n 1 83 ASN n 1 84 PHE n 1 85 GLY n 1 86 ILE n 1 87 CYS n 1 88 HIS n 1 89 ASN n 1 90 VAL n 1 91 GLY n 1 92 ARG n 1 93 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name pig _entity_src_gen.gene_src_genus Sus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sus scrofa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ PANCREAS _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COL_PIG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02703 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;VPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSIT NTNFGICHNVGRSDS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PCN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02703 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 93 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 93 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 OH non-polymer . 'HYDROXIDE ION' ? 'H O -1' 17.007 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1PCN _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1PCN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1PCN _struct.title 'SOLUTION STRUCTURE OF PORCINE PANCREATIC PROCOLIPASE AS DETERMINED FROM 1H HOMONUCLEAR TWO-AND THREE-DIMENSIONAL NMR' _struct.pdbx_descriptor 'PORCINE PANCREATIC PROCOLIPASE B (NMR, MINIMIZED AVERAGE STRUCTURE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PCN _struct_keywords.pdbx_keywords 'LIPASE PROTEIN COFACTOR' _struct_keywords.text 'LIPASE PROTEIN COFACTOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 19 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 22 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 19 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 22 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 17 A CYS 28 1_555 ? ? ? ? ? ? ? 2.005 ? disulf2 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 23 A CYS 39 1_555 ? ? ? ? ? ? ? 2.000 ? disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 61 SG ? ? A CYS 27 A CYS 61 1_555 ? ? ? ? ? ? ? 1.994 ? disulf4 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 69 SG ? ? A CYS 49 A CYS 69 1_555 ? ? ? ? ? ? ? 2.008 ? disulf5 disulf ? ? A CYS 63 SG ? ? ? 1_555 A CYS 87 SG ? ? A CYS 63 A CYS 87 1_555 ? ? ? ? ? ? ? 2.006 ? covale1 covale ? ? A SER 93 C ? ? ? 1_555 B OH . O ? ? A SER 93 A OH 94 1_555 ? ? ? ? ? ? ? 1.368 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 3 ? S2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel S2 1 2 ? anti-parallel S2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 GLU A 15 ? CYS A 17 ? GLU A 15 CYS A 17 S1 2 SER A 37 ? ALA A 40 ? SER A 37 ALA A 40 S1 3 CYS A 27 ? HIS A 30 ? CYS A 27 HIS A 30 S2 1 SER A 47 ? ALA A 51 ? SER A 47 ALA A 51 S2 2 ASN A 83 ? HIS A 88 ? ASN A 83 HIS A 88 S2 3 THR A 68 ? GLU A 70 ? THR A 68 GLU A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 N GLU A 15 ? N GLU A 15 O CYS A 39 ? O CYS A 39 S1 2 3 O ARG A 38 ? O ARG A 38 N GLN A 29 ? N GLN A 29 S2 1 2 N CYS A 49 ? N CYS A 49 O GLY A 85 ? O GLY A 85 S2 2 3 O ILE A 86 ? O ILE A 86 N GLU A 70 ? N GLU A 70 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE OH A 94' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id SER _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 93 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id SER _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 93 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _database_PDB_matrix.entry_id 1PCN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PCN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 SER 93 93 93 SER SER A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id OH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 94 _pdbx_nonpoly_scheme.auth_seq_num 94 _pdbx_nonpoly_scheme.pdb_mon_id OH _pdbx_nonpoly_scheme.auth_mon_id OH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-12-20 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.358 1.252 0.106 0.011 N 2 1 CD A GLU 15 ? ? OE2 A GLU 15 ? ? 1.359 1.252 0.107 0.011 N 3 1 CD A GLU 45 ? ? OE1 A GLU 45 ? ? 1.360 1.252 0.108 0.011 N 4 1 CD A GLU 48 ? ? OE1 A GLU 48 ? ? 1.359 1.252 0.107 0.011 N 5 1 CD A GLU 64 ? ? OE1 A GLU 64 ? ? 1.361 1.252 0.109 0.011 N 6 1 CD A GLU 70 ? ? OE2 A GLU 70 ? ? 1.364 1.252 0.112 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A PRO 2 ? ? CA A PRO 2 ? ? C A PRO 2 ? ? 137.37 112.10 25.27 2.60 N 2 1 CB A ASP 3 ? ? CG A ASP 3 ? ? OD1 A ASP 3 ? ? 111.70 118.30 -6.60 0.90 N 3 1 N A ARG 5 ? ? CA A ARG 5 ? ? CB A ARG 5 ? ? 125.42 110.60 14.82 1.80 N 4 1 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.31 120.30 4.01 0.50 N 5 1 CB A ASP 12 ? ? CG A ASP 12 ? ? OD2 A ASP 12 ? ? 112.57 118.30 -5.73 0.90 N 6 1 ND1 A HIS 30 ? ? CE1 A HIS 30 ? ? NE2 A HIS 30 ? ? 120.39 111.50 8.89 1.30 N 7 1 CB A ASP 31 ? ? CG A ASP 31 ? ? OD1 A ASP 31 ? ? 124.42 118.30 6.12 0.90 N 8 1 CB A ASP 31 ? ? CG A ASP 31 ? ? OD2 A ASP 31 ? ? 111.56 118.30 -6.74 0.90 N 9 1 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 124.35 120.30 4.05 0.50 N 10 1 N A ALA 40 ? ? CA A ALA 40 ? ? CB A ALA 40 ? ? 101.57 110.10 -8.53 1.40 N 11 1 NE A ARG 44 ? ? CZ A ARG 44 ? ? NH1 A ARG 44 ? ? 124.29 120.30 3.99 0.50 N 12 1 CB A TYR 58 ? ? CG A TYR 58 ? ? CD2 A TYR 58 ? ? 117.01 121.00 -3.99 0.60 N 13 1 CD A LYS 60 ? ? CE A LYS 60 ? ? NZ A LYS 60 ? ? 132.04 111.70 20.34 2.30 N 14 1 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 124.37 120.30 4.07 0.50 N 15 1 CB A ASP 72 ? ? CG A ASP 72 ? ? OD1 A ASP 72 ? ? 112.47 118.30 -5.83 0.90 N 16 1 ND1 A HIS 88 ? ? CE1 A HIS 88 ? ? NE2 A HIS 88 ? ? 119.96 111.50 8.46 1.30 N 17 1 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.28 120.30 3.98 0.50 N 18 1 N A SER 93 ? ? CA A SER 93 ? ? CB A SER 93 ? ? 129.12 110.50 18.62 1.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -26.78 52.47 2 1 ASP A 3 ? ? 76.98 154.46 3 1 ILE A 9 ? ? -122.39 -163.42 4 1 ASN A 10 ? ? 86.91 79.58 5 1 LEU A 18 ? ? -88.96 -74.11 6 1 ASN A 26 ? ? -69.88 84.08 7 1 CYS A 27 ? ? -161.34 77.29 8 1 ASP A 31 ? ? -73.09 38.07 9 1 THR A 32 ? ? 68.36 85.13 10 1 ILE A 33 ? ? 61.34 -29.75 11 1 SER A 35 ? ? 84.90 0.24 12 1 LYS A 73 ? ? -156.80 -81.37 13 1 ARG A 92 ? ? -129.59 -61.06 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 55 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.127 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 CA ? A VAL 1 ? 'WRONG HAND' . 2 1 CA ? A PRO 2 ? PLANAR . 3 1 CA ? A SER 78 ? 'WRONG HAND' . # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HYDROXIDE ION' _pdbx_entity_nonpoly.comp_id OH #