data_1PD6 # _entry.id 1PD6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PD6 pdb_00001pd6 10.2210/pdb1pd6/pdb RCSB RCSB019245 ? ? WWPDB D_1000019245 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-03 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PD6 _pdbx_database_status.recvd_initial_deposition_date 2003-05-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1GXE _pdbx_database_related.details 'the first structure of a domain of Myosin Binding Protein C' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ababou, A.' 1 'Gautel, M.' 2 'Pfuhl, M.' 3 # _citation.id primary _citation.title 'Dissecting the N-terminal myosin binding site of human cardiac myosin-binding protein C. Structure and myosin binding of domain C2' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 282 _citation.page_first 9204 _citation.page_last 9215 _citation.year 2007 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17192269 _citation.pdbx_database_id_DOI 10.1074/jbc.M610899200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ababou, A.' 1 ? primary 'Gautel, M.' 2 ? primary 'Pfuhl, M.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Myosin-binding protein C, cardiac-type, Domain C2' _entity.formula_weight 11765.365 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Domain C2' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'cardiac myosin-binding protein C; Cardiac MyBP-C; protein C, cardiac' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSMDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCS LADDAAYQCVVGGEKCSTELFVKE ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSMDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCS LADDAAYQCVVGGEKCSTELFVKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 MET n 1 11 ASP n 1 12 GLU n 1 13 LYS n 1 14 LYS n 1 15 SER n 1 16 THR n 1 17 ALA n 1 18 PHE n 1 19 GLN n 1 20 LYS n 1 21 LYS n 1 22 LEU n 1 23 GLU n 1 24 PRO n 1 25 ALA n 1 26 TYR n 1 27 GLN n 1 28 VAL n 1 29 SER n 1 30 LYS n 1 31 GLY n 1 32 HIS n 1 33 LYS n 1 34 ILE n 1 35 ARG n 1 36 LEU n 1 37 THR n 1 38 VAL n 1 39 GLU n 1 40 LEU n 1 41 ALA n 1 42 ASP n 1 43 HIS n 1 44 ASP n 1 45 ALA n 1 46 GLU n 1 47 VAL n 1 48 LYS n 1 49 TRP n 1 50 LEU n 1 51 LYS n 1 52 ASN n 1 53 GLY n 1 54 GLN n 1 55 GLU n 1 56 ILE n 1 57 GLN n 1 58 MET n 1 59 SER n 1 60 GLY n 1 61 SER n 1 62 LYS n 1 63 TYR n 1 64 ILE n 1 65 PHE n 1 66 GLU n 1 67 SER n 1 68 ILE n 1 69 GLY n 1 70 ALA n 1 71 LYS n 1 72 ARG n 1 73 THR n 1 74 LEU n 1 75 THR n 1 76 ILE n 1 77 SER n 1 78 GLN n 1 79 CYS n 1 80 SER n 1 81 LEU n 1 82 ALA n 1 83 ASP n 1 84 ASP n 1 85 ALA n 1 86 ALA n 1 87 TYR n 1 88 GLN n 1 89 CYS n 1 90 VAL n 1 91 VAL n 1 92 GLY n 1 93 GLY n 1 94 GLU n 1 95 LYS n 1 96 CYS n 1 97 SER n 1 98 THR n 1 99 GLU n 1 100 LEU n 1 101 PHE n 1 102 VAL n 1 103 LYS n 1 104 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene MYBPC3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue muscle _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ heart _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21* _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-8a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 198 ? ? ? A . n A 1 2 HIS 2 199 ? ? ? A . n A 1 3 HIS 3 200 ? ? ? A . n A 1 4 HIS 4 201 ? ? ? A . n A 1 5 HIS 5 202 ? ? ? A . n A 1 6 HIS 6 203 ? ? ? A . n A 1 7 HIS 7 204 ? ? ? A . n A 1 8 SER 8 205 ? ? ? A . n A 1 9 SER 9 206 ? ? ? A . n A 1 10 MET 10 207 ? ? ? A . n A 1 11 ASP 11 208 208 ASP ASP A . n A 1 12 GLU 12 209 209 GLU GLU A . n A 1 13 LYS 13 210 210 LYS LYS A . n A 1 14 LYS 14 211 211 LYS LYS A . n A 1 15 SER 15 212 212 SER SER A . n A 1 16 THR 16 213 213 THR THR A . n A 1 17 ALA 17 214 214 ALA ALA A . n A 1 18 PHE 18 215 215 PHE PHE A . n A 1 19 GLN 19 216 216 GLN GLN A . n A 1 20 LYS 20 217 217 LYS LYS A . n A 1 21 LYS 21 218 218 LYS LYS A . n A 1 22 LEU 22 219 219 LEU LEU A . n A 1 23 GLU 23 220 220 GLU GLU A . n A 1 24 PRO 24 221 221 PRO PRO A . n A 1 25 ALA 25 222 222 ALA ALA A . n A 1 26 TYR 26 223 223 TYR TYR A . n A 1 27 GLN 27 224 224 GLN GLN A . n A 1 28 VAL 28 225 225 VAL VAL A . n A 1 29 SER 29 226 226 SER SER A . n A 1 30 LYS 30 227 227 LYS LYS A . n A 1 31 GLY 31 228 228 GLY GLY A . n A 1 32 HIS 32 229 229 HIS HIS A . n A 1 33 LYS 33 230 230 LYS LYS A . n A 1 34 ILE 34 231 231 ILE ILE A . n A 1 35 ARG 35 232 232 ARG ARG A . n A 1 36 LEU 36 233 233 LEU LEU A . n A 1 37 THR 37 234 234 THR THR A . n A 1 38 VAL 38 235 235 VAL VAL A . n A 1 39 GLU 39 236 236 GLU GLU A . n A 1 40 LEU 40 237 237 LEU LEU A . n A 1 41 ALA 41 238 238 ALA ALA A . n A 1 42 ASP 42 239 239 ASP ASP A . n A 1 43 HIS 43 240 240 HIS HIS A . n A 1 44 ASP 44 241 241 ASP ASP A . n A 1 45 ALA 45 242 242 ALA ALA A . n A 1 46 GLU 46 243 243 GLU GLU A . n A 1 47 VAL 47 244 244 VAL VAL A . n A 1 48 LYS 48 245 245 LYS LYS A . n A 1 49 TRP 49 246 246 TRP TRP A . n A 1 50 LEU 50 247 247 LEU LEU A . n A 1 51 LYS 51 248 248 LYS LYS A . n A 1 52 ASN 52 249 249 ASN ASN A . n A 1 53 GLY 53 250 250 GLY GLY A . n A 1 54 GLN 54 251 251 GLN GLN A . n A 1 55 GLU 55 252 252 GLU GLU A . n A 1 56 ILE 56 253 253 ILE ILE A . n A 1 57 GLN 57 254 254 GLN GLN A . n A 1 58 MET 58 255 255 MET MET A . n A 1 59 SER 59 256 256 SER SER A . n A 1 60 GLY 60 257 257 GLY GLY A . n A 1 61 SER 61 258 258 SER SER A . n A 1 62 LYS 62 259 259 LYS LYS A . n A 1 63 TYR 63 260 260 TYR TYR A . n A 1 64 ILE 64 261 261 ILE ILE A . n A 1 65 PHE 65 262 262 PHE PHE A . n A 1 66 GLU 66 263 263 GLU GLU A . n A 1 67 SER 67 264 264 SER SER A . n A 1 68 ILE 68 265 265 ILE ILE A . n A 1 69 GLY 69 266 266 GLY GLY A . n A 1 70 ALA 70 267 267 ALA ALA A . n A 1 71 LYS 71 268 268 LYS LYS A . n A 1 72 ARG 72 269 269 ARG ARG A . n A 1 73 THR 73 270 270 THR THR A . n A 1 74 LEU 74 271 271 LEU LEU A . n A 1 75 THR 75 272 272 THR THR A . n A 1 76 ILE 76 273 273 ILE ILE A . n A 1 77 SER 77 274 274 SER SER A . n A 1 78 GLN 78 275 275 GLN GLN A . n A 1 79 CYS 79 276 276 CYS CYS A . n A 1 80 SER 80 277 277 SER SER A . n A 1 81 LEU 81 278 278 LEU LEU A . n A 1 82 ALA 82 279 279 ALA ALA A . n A 1 83 ASP 83 280 280 ASP ASP A . n A 1 84 ASP 84 281 281 ASP ASP A . n A 1 85 ALA 85 282 282 ALA ALA A . n A 1 86 ALA 86 283 283 ALA ALA A . n A 1 87 TYR 87 284 284 TYR TYR A . n A 1 88 GLN 88 285 285 GLN GLN A . n A 1 89 CYS 89 286 286 CYS CYS A . n A 1 90 VAL 90 287 287 VAL VAL A . n A 1 91 VAL 91 288 288 VAL VAL A . n A 1 92 GLY 92 289 289 GLY GLY A . n A 1 93 GLY 93 290 290 GLY GLY A . n A 1 94 GLU 94 291 291 GLU GLU A . n A 1 95 LYS 95 292 292 LYS LYS A . n A 1 96 CYS 96 293 293 CYS CYS A . n A 1 97 SER 97 294 294 SER SER A . n A 1 98 THR 98 295 295 THR THR A . n A 1 99 GLU 99 296 296 GLU GLU A . n A 1 100 LEU 100 297 297 LEU LEU A . n A 1 101 PHE 101 298 298 PHE PHE A . n A 1 102 VAL 102 299 299 VAL VAL A . n A 1 103 LYS 103 300 300 LYS LYS A . n A 1 104 GLU 104 301 301 GLU GLU A . n # _exptl.entry_id 1PD6 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1PD6 _struct.title 'The NMR structure of domain C2 of human cardiac Myosin Binding Protein C' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PD6 _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'Ig domain, STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code MYPC3_HUMAN _struct_ref.pdbx_db_accession Q14896 _struct_ref.pdbx_align_begin 358 _struct_ref.pdbx_seq_one_letter_code ;DEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV VGGEKCSTELFVKE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PD6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14896 _struct_ref_seq.db_align_beg 358 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 451 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 208 _struct_ref_seq.pdbx_auth_seq_align_end 301 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1PD6 MET A 1 ? UNP Q14896 ? ? 'expression tag' 198 1 1 1PD6 HIS A 2 ? UNP Q14896 ? ? 'expression tag' 199 2 1 1PD6 HIS A 3 ? UNP Q14896 ? ? 'expression tag' 200 3 1 1PD6 HIS A 4 ? UNP Q14896 ? ? 'expression tag' 201 4 1 1PD6 HIS A 5 ? UNP Q14896 ? ? 'expression tag' 202 5 1 1PD6 HIS A 6 ? UNP Q14896 ? ? 'expression tag' 203 6 1 1PD6 HIS A 7 ? UNP Q14896 ? ? 'expression tag' 204 7 1 1PD6 SER A 8 ? UNP Q14896 ? ? 'expression tag' 205 8 1 1PD6 SER A 9 ? UNP Q14896 ? ? 'expression tag' 206 9 1 1PD6 MET A 10 ? UNP Q14896 ? ? 'expression tag' 207 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 5 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 20 ? LYS A 21 ? LYS A 217 LYS A 218 A 2 ILE A 34 ? GLU A 39 ? ILE A 231 GLU A 236 A 3 LYS A 71 ? ILE A 76 ? LYS A 268 ILE A 273 A 4 ILE A 64 ? ILE A 68 ? ILE A 261 ILE A 265 B 1 ALA A 25 ? SER A 29 ? ALA A 222 SER A 226 B 2 GLU A 99 ? LYS A 103 ? GLU A 296 LYS A 300 B 3 ALA A 85 ? VAL A 91 ? ALA A 282 VAL A 288 B 4 LYS A 48 ? LYS A 51 ? LYS A 245 LYS A 248 B 5 GLU A 55 ? ILE A 56 ? GLU A 252 ILE A 253 C 1 ALA A 25 ? SER A 29 ? ALA A 222 SER A 226 C 2 GLU A 99 ? LYS A 103 ? GLU A 296 LYS A 300 C 3 ALA A 85 ? VAL A 91 ? ALA A 282 VAL A 288 C 4 GLU A 94 ? CYS A 96 ? GLU A 291 CYS A 293 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 20 ? N LYS A 217 O GLU A 39 ? O GLU A 236 A 2 3 N ILE A 34 ? N ILE A 231 O ILE A 76 ? O ILE A 273 A 3 4 O THR A 75 ? O THR A 272 N ILE A 64 ? N ILE A 261 B 1 2 N TYR A 26 ? N TYR A 223 O PHE A 101 ? O PHE A 298 B 2 3 O LEU A 100 ? O LEU A 297 N ALA A 85 ? N ALA A 282 B 3 4 O GLN A 88 ? O GLN A 285 N LEU A 50 ? N LEU A 247 B 4 5 N TRP A 49 ? N TRP A 246 O ILE A 56 ? O ILE A 253 C 1 2 N TYR A 26 ? N TYR A 223 O PHE A 101 ? O PHE A 298 C 2 3 O LEU A 100 ? O LEU A 297 N ALA A 85 ? N ALA A 282 C 3 4 N CYS A 89 ? N CYS A 286 O CYS A 96 ? O CYS A 293 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.96 2 1 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.29 3 1 HD2 A LYS 227 ? ? HA A GLU 301 ? ? 1.34 4 2 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.96 5 2 HG13 A ILE 273 ? ? HE2 A TYR 284 ? ? 1.33 6 2 HG3 A GLN 285 ? ? HA A SER 294 ? ? 1.35 7 2 O A VAL 225 ? ? H A LYS 300 ? ? 1.55 8 2 O A SER 212 ? ? HG1 A THR 213 ? ? 1.56 9 3 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.93 10 3 HE3 A LYS 218 ? ? HB A THR 295 ? ? 1.13 11 3 HG11 A VAL 235 ? ? HH2 A TRP 246 ? ? 1.26 12 3 HD23 A LEU 247 ? ? HA A GLU 252 ? ? 1.33 13 3 O A VAL 225 ? ? H A LYS 300 ? ? 1.57 14 4 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.92 15 4 HG23 A ILE 231 ? ? HG23 A ILE 273 ? ? 1.19 16 4 HD22 A LEU 247 ? ? HA A GLU 252 ? ? 1.34 17 4 O A SER 212 ? ? HG1 A THR 213 ? ? 1.58 18 4 O A VAL 225 ? ? H A LYS 300 ? ? 1.59 19 5 HZ3 A LYS 248 ? ? HH A TYR 284 ? ? 0.94 20 5 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 1.00 21 5 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.28 22 5 O A SER 212 ? ? HG1 A THR 213 ? ? 1.55 23 5 O A VAL 225 ? ? H A LYS 300 ? ? 1.60 24 6 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.96 25 6 HZ1 A LYS 259 ? ? HH A TYR 260 ? ? 1.02 26 6 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.31 27 6 HD22 A LEU 247 ? ? HA A GLU 252 ? ? 1.33 28 6 HG21 A VAL 244 ? ? HG2 A ARG 269 ? ? 1.34 29 6 O A VAL 225 ? ? H A LYS 300 ? ? 1.58 30 7 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 1.00 31 7 HG13 A ILE 273 ? ? HE2 A TYR 284 ? ? 1.33 32 7 O A VAL 225 ? ? H A LYS 300 ? ? 1.58 33 8 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.94 34 8 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.33 35 8 H A SER 212 ? ? H A THR 213 ? ? 1.34 36 8 O A VAL 225 ? ? H A LYS 300 ? ? 1.57 37 8 O A LYS 211 ? ? HG A SER 212 ? ? 1.60 38 9 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.91 39 9 O A VAL 225 ? ? H A LYS 300 ? ? 1.58 40 10 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 1.00 41 10 HE3 A LYS 218 ? ? HB A THR 295 ? ? 1.13 42 10 O A VAL 225 ? ? H A LYS 300 ? ? 1.57 43 10 O A SER 212 ? ? HG1 A THR 213 ? ? 1.58 44 10 O A LYS 217 ? ? H A GLU 236 ? ? 1.58 45 10 OE1 A GLU 236 ? ? HZ1 A LYS 268 ? ? 1.60 46 11 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.94 47 11 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.33 48 11 O A VAL 225 ? ? H A LYS 300 ? ? 1.57 49 12 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.91 50 12 O A VAL 225 ? ? H A LYS 300 ? ? 1.57 51 12 HZ2 A LYS 211 ? ? O A GLN 216 ? ? 1.58 52 13 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 1.04 53 13 HG11 A VAL 235 ? ? HH2 A TRP 246 ? ? 1.29 54 13 HD23 A LEU 247 ? ? HA A GLU 252 ? ? 1.34 55 13 O A LYS 210 ? ? HG A CYS 293 ? ? 1.58 56 13 O A VAL 225 ? ? H A LYS 300 ? ? 1.58 57 13 HZ1 A LYS 248 ? ? OD1 A ASP 280 ? ? 1.59 58 14 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.94 59 14 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.29 60 14 HG23 A ILE 231 ? ? HG22 A ILE 273 ? ? 1.31 61 14 O A VAL 225 ? ? H A LYS 300 ? ? 1.56 62 15 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 1.01 63 15 HD2 A LYS 227 ? ? HA A GLU 301 ? ? 1.25 64 15 O A VAL 225 ? ? H A LYS 300 ? ? 1.59 65 16 HZ3 A LYS 248 ? ? HH A TYR 284 ? ? 0.99 66 16 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 1.05 67 16 HE22 A GLN 251 ? ? HH A TYR 260 ? ? 1.24 68 16 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.34 69 16 HG13 A VAL 235 ? ? HH2 A TRP 246 ? ? 1.35 70 16 O A SER 212 ? ? HG1 A THR 213 ? ? 1.57 71 16 HG A CYS 276 ? ? OD2 A ASP 280 ? ? 1.60 72 17 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.94 73 17 HZ1 A LYS 248 ? ? HH A TYR 284 ? ? 1.09 74 17 O A VAL 225 ? ? H A LYS 300 ? ? 1.59 75 17 H A LYS 248 ? ? O A GLN 251 ? ? 1.59 76 17 O A ILE 231 ? ? H A ILE 273 ? ? 1.60 77 18 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.98 78 18 HG3 A GLN 285 ? ? HA A SER 294 ? ? 1.30 79 18 O A LYS 210 ? ? HG A CYS 293 ? ? 1.60 80 19 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.99 81 19 HG12 A VAL 235 ? ? HH2 A TRP 246 ? ? 1.33 82 19 O A VAL 225 ? ? H A LYS 300 ? ? 1.58 83 19 HZ2 A LYS 248 ? ? OD1 A ASP 280 ? ? 1.58 84 19 O A SER 212 ? ? HG1 A THR 213 ? ? 1.59 85 20 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.96 86 20 HG11 A VAL 235 ? ? HH2 A TRP 246 ? ? 1.22 87 20 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.32 88 20 O A VAL 225 ? ? H A LYS 300 ? ? 1.56 89 21 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.94 90 21 HD2 A LYS 227 ? ? HA A GLU 301 ? ? 1.30 91 21 O A ILE 231 ? ? H A ILE 273 ? ? 1.57 92 21 O A VAL 225 ? ? H A LYS 300 ? ? 1.57 93 21 O A ILE 261 ? ? H A THR 272 ? ? 1.59 94 21 HZ3 A LYS 211 ? ? O A GLN 216 ? ? 1.60 95 22 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 1.00 96 22 HG12 A VAL 235 ? ? HH2 A TRP 246 ? ? 1.24 97 22 HA A SER 212 ? ? HB2 A CYS 293 ? ? 1.30 98 22 O A VAL 225 ? ? H A LYS 300 ? ? 1.57 99 23 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.94 100 23 HE3 A LYS 218 ? ? HB A THR 295 ? ? 1.20 101 23 HG13 A VAL 235 ? ? HH2 A TRP 246 ? ? 1.26 102 23 HG21 A VAL 244 ? ? HG2 A ARG 269 ? ? 1.29 103 23 HZ2 A LYS 218 ? ? HH A TYR 223 ? ? 1.29 104 23 O A VAL 225 ? ? H A LYS 300 ? ? 1.57 105 23 O A SER 212 ? ? HG1 A THR 213 ? ? 1.58 106 23 O A ILE 231 ? ? H A ILE 273 ? ? 1.59 107 23 HG A CYS 276 ? ? OD2 A ASP 280 ? ? 1.60 108 23 HG A SER 212 ? ? OE1 A GLU 291 ? ? 1.60 109 24 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.99 110 24 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.32 111 25 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 1.00 112 25 HB2 A TRP 246 ? ? HE2 A TYR 260 ? ? 1.08 113 25 HG3 A GLN 285 ? ? HA A SER 294 ? ? 1.18 114 25 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.29 115 26 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.91 116 26 HG11 A VAL 235 ? ? HH2 A TRP 246 ? ? 1.30 117 26 HB2 A LEU 233 ? ? HB3 A LEU 271 ? ? 1.30 118 27 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 0.87 119 27 HE1 A PHE 215 ? ? HG23 A VAL 288 ? ? 1.19 120 27 HA A SER 212 ? ? HB2 A CYS 293 ? ? 1.22 121 27 HG3 A GLN 285 ? ? HA A SER 294 ? ? 1.30 122 27 HD2 A LYS 227 ? ? HA A GLU 301 ? ? 1.32 123 27 HG12 A VAL 235 ? ? HH2 A TRP 246 ? ? 1.34 124 27 O A LYS 217 ? ? H A GLU 236 ? ? 1.59 125 27 O A VAL 225 ? ? H A LYS 300 ? ? 1.59 126 27 H A LYS 248 ? ? O A GLN 251 ? ? 1.60 127 28 HB3 A LEU 247 ? ? HE21 A GLN 285 ? ? 1.05 128 28 HZ3 A LYS 248 ? ? HH A TYR 260 ? ? 1.12 129 28 HG23 A VAL 244 ? ? HG2 A ARG 269 ? ? 1.15 130 28 HG11 A VAL 235 ? ? HH2 A TRP 246 ? ? 1.32 131 28 HZ3 A LYS 248 ? ? OH A TYR 260 ? ? 1.56 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 4 CZ A TYR 223 ? ? CE2 A TYR 223 ? ? 1.300 1.381 -0.081 0.013 N 2 11 CE1 A TYR 223 ? ? CZ A TYR 223 ? ? 1.489 1.381 0.108 0.013 N 3 11 CZ A TYR 223 ? ? CE2 A TYR 223 ? ? 1.278 1.381 -0.103 0.013 N 4 13 CZ A TYR 223 ? ? CE2 A TYR 223 ? ? 1.301 1.381 -0.080 0.013 N 5 16 CZ A TYR 260 ? ? CE2 A TYR 260 ? ? 1.301 1.381 -0.080 0.013 N 6 22 CE1 A TYR 223 ? ? CZ A TYR 223 ? ? 1.462 1.381 0.081 0.013 N 7 22 CZ A TYR 223 ? ? CE2 A TYR 223 ? ? 1.289 1.381 -0.092 0.013 N 8 23 CZ A TYR 223 ? ? CE2 A TYR 223 ? ? 1.302 1.381 -0.079 0.013 N 9 24 CE1 A TYR 223 ? ? CZ A TYR 223 ? ? 1.476 1.381 0.095 0.013 N 10 24 CZ A TYR 223 ? ? CE2 A TYR 223 ? ? 1.289 1.381 -0.092 0.013 N 11 25 CE1 A TYR 223 ? ? CZ A TYR 223 ? ? 1.470 1.381 0.089 0.013 N 12 25 CZ A TYR 223 ? ? CE2 A TYR 223 ? ? 1.284 1.381 -0.097 0.013 N 13 26 CZ A TYR 223 ? ? CE2 A TYR 223 ? ? 1.302 1.381 -0.079 0.013 N 14 26 CE1 A TYR 284 ? ? CZ A TYR 284 ? ? 1.299 1.381 -0.082 0.013 N 15 28 CE1 A TYR 223 ? ? CZ A TYR 223 ? ? 1.484 1.381 0.103 0.013 N 16 28 CZ A TYR 223 ? ? CE2 A TYR 223 ? ? 1.274 1.381 -0.107 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 212 ? ? 177.04 -40.45 2 1 THR A 213 ? ? -48.17 155.70 3 1 ALA A 214 ? ? -71.15 28.28 4 1 PRO A 221 ? ? -66.39 36.27 5 1 ALA A 222 ? ? -157.53 84.34 6 1 LYS A 230 ? ? 71.12 107.63 7 1 HIS A 240 ? ? 78.94 -57.79 8 1 ASN A 249 ? ? -47.31 106.60 9 1 GLN A 254 ? ? -83.07 -121.67 10 1 SER A 258 ? ? -156.12 -27.02 11 1 ALA A 267 ? ? 75.97 -39.34 12 1 SER A 277 ? ? -148.34 -129.27 13 1 ALA A 279 ? ? -157.51 -46.30 14 1 ALA A 282 ? ? -171.17 -112.32 15 2 LYS A 210 ? ? 175.80 153.57 16 2 SER A 212 ? ? -157.40 -115.19 17 2 THR A 213 ? ? 53.45 -168.06 18 2 PRO A 221 ? ? -66.35 40.88 19 2 ALA A 222 ? ? -163.18 81.42 20 2 LYS A 230 ? ? 69.49 108.94 21 2 HIS A 240 ? ? 74.67 -34.50 22 2 ASP A 241 ? ? -158.02 69.33 23 2 SER A 256 ? ? -150.82 -151.83 24 2 SER A 258 ? ? -160.11 -65.50 25 2 SER A 277 ? ? -78.23 -133.93 26 2 ALA A 279 ? ? -165.85 -44.50 27 2 ASP A 281 ? ? -15.39 116.91 28 2 ALA A 282 ? ? -177.14 -112.14 29 3 LYS A 210 ? ? 177.73 -107.16 30 3 SER A 212 ? ? -176.88 -131.32 31 3 PRO A 221 ? ? -63.93 35.68 32 3 ALA A 222 ? ? -160.10 87.31 33 3 HIS A 229 ? ? -86.87 -71.48 34 3 LYS A 230 ? ? 158.48 113.14 35 3 HIS A 240 ? ? 76.51 -55.74 36 3 ASN A 249 ? ? -47.03 108.03 37 3 GLN A 254 ? ? -83.11 -110.50 38 3 CYS A 276 ? ? -154.45 62.80 39 3 SER A 277 ? ? -89.51 -129.00 40 3 ALA A 279 ? ? -164.54 -43.92 41 3 ALA A 282 ? ? -171.61 -118.34 42 4 LYS A 210 ? ? -150.77 -112.61 43 4 SER A 212 ? ? -163.88 -125.04 44 4 THR A 213 ? ? 52.86 -173.80 45 4 PRO A 221 ? ? -66.45 37.10 46 4 ALA A 222 ? ? -157.19 85.42 47 4 LYS A 230 ? ? 69.76 107.53 48 4 HIS A 240 ? ? 75.38 -62.77 49 4 ASP A 241 ? ? -108.12 57.00 50 4 SER A 256 ? ? -151.55 -159.85 51 4 GLN A 275 ? ? 60.23 73.60 52 4 CYS A 276 ? ? -161.14 118.76 53 4 SER A 277 ? ? -151.14 -138.21 54 4 ALA A 279 ? ? -156.41 -49.39 55 4 ALA A 282 ? ? -172.73 -126.94 56 5 LYS A 210 ? ? -146.64 -139.86 57 5 SER A 212 ? ? -141.53 -129.58 58 5 THR A 213 ? ? 60.73 170.04 59 5 PRO A 221 ? ? -67.02 30.42 60 5 ALA A 222 ? ? -150.80 85.35 61 5 LYS A 230 ? ? 72.49 108.56 62 5 HIS A 240 ? ? 76.68 -46.09 63 5 ASN A 249 ? ? -40.36 105.26 64 5 GLN A 254 ? ? -88.05 -121.67 65 5 ALA A 267 ? ? 78.77 -42.94 66 5 GLN A 275 ? ? 56.40 76.50 67 5 CYS A 276 ? ? -153.86 42.02 68 5 SER A 277 ? ? -85.43 -134.27 69 5 LEU A 278 ? ? -69.69 59.55 70 5 ALA A 279 ? ? -171.66 -46.68 71 5 ALA A 282 ? ? -177.52 -114.93 72 6 LYS A 210 ? ? -170.67 -165.58 73 6 SER A 212 ? ? 179.02 -44.58 74 6 THR A 213 ? ? -46.42 153.95 75 6 ALA A 214 ? ? -70.65 30.55 76 6 PRO A 221 ? ? -66.08 41.31 77 6 ALA A 222 ? ? -164.44 82.82 78 6 LYS A 230 ? ? 64.17 113.94 79 6 HIS A 240 ? ? 74.99 -49.06 80 6 ASN A 249 ? ? -37.48 104.12 81 6 MET A 255 ? ? 76.87 148.85 82 6 SER A 258 ? ? -167.93 -58.65 83 6 ALA A 267 ? ? 74.80 -41.15 84 6 CYS A 276 ? ? -151.01 56.55 85 6 SER A 277 ? ? -84.32 -130.19 86 6 ALA A 279 ? ? -156.77 -46.20 87 6 ASP A 281 ? ? -57.98 102.59 88 6 ALA A 282 ? ? -167.32 -109.61 89 7 SER A 212 ? ? -160.36 -106.55 90 7 THR A 213 ? ? 49.75 -158.74 91 7 PRO A 221 ? ? -64.78 30.96 92 7 LYS A 230 ? ? 51.92 106.37 93 7 HIS A 240 ? ? 77.04 -49.26 94 7 ASN A 249 ? ? -44.26 101.36 95 7 GLN A 254 ? ? -92.07 -117.99 96 7 ALA A 267 ? ? 75.85 -38.74 97 7 CYS A 276 ? ? -154.36 54.48 98 7 SER A 277 ? ? -92.34 -131.65 99 7 ALA A 279 ? ? -156.88 -50.02 100 7 ALA A 282 ? ? 175.54 -99.84 101 8 SER A 212 ? ? -175.24 -20.60 102 8 THR A 213 ? ? -69.58 24.21 103 8 PRO A 221 ? ? -66.11 37.81 104 8 ALA A 222 ? ? -159.76 84.68 105 8 LYS A 230 ? ? 59.01 112.16 106 8 HIS A 240 ? ? 78.05 -54.68 107 8 GLN A 254 ? ? -87.83 -122.21 108 8 SER A 258 ? ? -166.45 -71.52 109 8 ALA A 267 ? ? 75.79 -42.52 110 8 SER A 277 ? ? -154.04 -140.98 111 8 LEU A 278 ? ? -73.00 48.45 112 8 ALA A 279 ? ? -162.39 -48.64 113 8 ASP A 281 ? ? -30.35 121.50 114 8 ALA A 282 ? ? -176.66 -114.52 115 9 LYS A 211 ? ? -57.92 109.71 116 9 SER A 212 ? ? -167.37 -107.17 117 9 THR A 213 ? ? 52.65 18.66 118 9 PRO A 221 ? ? -65.23 34.07 119 9 ALA A 222 ? ? -159.59 87.79 120 9 HIS A 229 ? ? -83.20 -70.97 121 9 LYS A 230 ? ? 157.43 110.74 122 9 HIS A 240 ? ? 75.14 -52.06 123 9 ASN A 249 ? ? -45.19 104.69 124 9 GLN A 254 ? ? -82.39 -105.67 125 9 MET A 255 ? ? -175.95 143.02 126 9 SER A 256 ? ? -165.69 -160.67 127 9 ALA A 267 ? ? 77.76 -39.11 128 9 SER A 277 ? ? -155.20 -131.34 129 9 ALA A 279 ? ? -157.99 -50.04 130 9 ALA A 282 ? ? 175.67 -103.09 131 10 LYS A 210 ? ? -149.86 -110.38 132 10 SER A 212 ? ? -166.77 -129.26 133 10 THR A 213 ? ? 55.46 174.14 134 10 PRO A 221 ? ? -66.14 32.41 135 10 ALA A 222 ? ? -152.94 84.27 136 10 LYS A 230 ? ? 70.42 106.45 137 10 HIS A 240 ? ? 75.05 -72.93 138 10 ASP A 241 ? ? -94.52 39.95 139 10 ASN A 249 ? ? -42.41 106.40 140 10 GLN A 254 ? ? -77.63 -133.15 141 10 SER A 258 ? ? -157.68 -72.72 142 10 ALA A 267 ? ? 77.85 -38.36 143 10 SER A 277 ? ? -148.14 -119.28 144 10 ALA A 279 ? ? -157.33 -43.43 145 10 ASP A 281 ? ? -42.10 101.30 146 10 ALA A 282 ? ? 175.49 154.20 147 11 LYS A 210 ? ? 178.18 158.29 148 11 SER A 212 ? ? -175.87 -99.39 149 11 THR A 213 ? ? 46.88 -139.19 150 11 PRO A 221 ? ? -68.72 32.35 151 11 ALA A 222 ? ? -158.59 89.51 152 11 LYS A 230 ? ? 72.80 110.40 153 11 HIS A 240 ? ? 77.63 -50.17 154 11 ASN A 249 ? ? -45.79 108.19 155 11 GLN A 254 ? ? -92.16 -124.30 156 11 LYS A 259 ? ? 174.04 150.56 157 11 ALA A 267 ? ? 77.45 -42.13 158 11 GLN A 275 ? ? 59.65 71.38 159 11 CYS A 276 ? ? -153.87 36.08 160 11 SER A 277 ? ? -80.10 -134.62 161 11 ALA A 279 ? ? -168.10 -42.57 162 11 ALA A 282 ? ? -175.12 -111.89 163 12 LYS A 210 ? ? -113.67 -73.92 164 12 SER A 212 ? ? 178.81 -53.31 165 12 ALA A 214 ? ? -75.41 32.89 166 12 PRO A 221 ? ? -68.31 43.23 167 12 ALA A 222 ? ? -156.22 81.49 168 12 LYS A 230 ? ? 58.71 113.70 169 12 HIS A 240 ? ? 74.54 -36.13 170 12 ASP A 241 ? ? -148.45 46.03 171 12 ASN A 249 ? ? -42.30 102.05 172 12 GLN A 254 ? ? -81.94 -120.47 173 12 SER A 256 ? ? -142.48 -157.61 174 12 SER A 258 ? ? -155.65 -58.26 175 12 CYS A 276 ? ? -141.23 58.13 176 12 SER A 277 ? ? -91.44 -128.73 177 12 ALA A 279 ? ? -161.45 -46.75 178 12 ALA A 282 ? ? -176.02 -114.40 179 13 SER A 212 ? ? -169.25 -43.20 180 13 ALA A 214 ? ? -77.62 25.00 181 13 PRO A 221 ? ? -66.07 32.61 182 13 ALA A 222 ? ? -150.65 83.46 183 13 LYS A 230 ? ? 71.95 108.76 184 13 HIS A 240 ? ? 86.27 -42.72 185 13 ASN A 249 ? ? -41.46 102.98 186 13 GLN A 254 ? ? -89.54 -132.21 187 13 SER A 258 ? ? -75.55 -70.36 188 13 ALA A 267 ? ? 75.44 -38.44 189 13 CYS A 276 ? ? -143.90 56.08 190 13 SER A 277 ? ? -89.12 -128.77 191 13 ALA A 279 ? ? -166.98 -42.18 192 13 ALA A 282 ? ? 179.75 -107.06 193 14 SER A 212 ? ? -101.34 -81.27 194 14 THR A 213 ? ? 49.12 -160.99 195 14 PRO A 221 ? ? -66.74 35.08 196 14 ALA A 222 ? ? -161.43 94.03 197 14 LYS A 230 ? ? 69.93 107.26 198 14 HIS A 240 ? ? 77.09 -50.01 199 14 ASN A 249 ? ? -45.10 105.73 200 14 GLN A 275 ? ? 59.63 70.97 201 14 CYS A 276 ? ? -150.20 41.57 202 14 SER A 277 ? ? -84.15 -130.30 203 14 ALA A 279 ? ? -165.09 -50.68 204 14 ASP A 281 ? ? 15.29 91.37 205 14 ALA A 282 ? ? -151.22 -126.95 206 15 SER A 212 ? ? -161.33 -98.05 207 15 THR A 213 ? ? 50.25 -155.68 208 15 PRO A 221 ? ? -65.07 28.85 209 15 ALA A 222 ? ? -153.56 86.78 210 15 LYS A 230 ? ? 70.96 108.22 211 15 HIS A 240 ? ? 76.83 -63.77 212 15 ASN A 249 ? ? -38.93 102.84 213 15 GLN A 254 ? ? -88.07 -117.40 214 15 LYS A 259 ? ? 174.07 147.86 215 15 ALA A 267 ? ? 77.65 -36.88 216 15 GLN A 275 ? ? 60.46 67.28 217 15 SER A 277 ? ? -155.28 -133.27 218 15 ALA A 279 ? ? -157.06 -47.32 219 15 ALA A 282 ? ? -172.72 -114.34 220 16 SER A 212 ? ? -151.49 -117.35 221 16 THR A 213 ? ? 57.18 163.29 222 16 PRO A 221 ? ? -65.95 29.84 223 16 LYS A 230 ? ? 71.86 111.54 224 16 HIS A 240 ? ? 80.57 -62.06 225 16 ASN A 249 ? ? -42.57 102.32 226 16 GLN A 254 ? ? -78.69 -72.70 227 16 MET A 255 ? ? 169.70 134.66 228 16 SER A 258 ? ? -90.43 -61.02 229 16 GLN A 275 ? ? 60.71 73.56 230 16 CYS A 276 ? ? -150.48 40.74 231 16 SER A 277 ? ? -80.93 -128.24 232 16 ALA A 279 ? ? -160.65 -43.06 233 16 ASP A 281 ? ? -58.18 109.98 234 16 ALA A 282 ? ? -173.83 -109.66 235 17 SER A 212 ? ? -160.62 -38.94 236 17 THR A 213 ? ? -53.08 170.61 237 17 PRO A 221 ? ? -67.13 33.88 238 17 ALA A 222 ? ? -154.34 84.05 239 17 LYS A 230 ? ? 54.75 113.67 240 17 HIS A 240 ? ? 77.58 -58.90 241 17 ASN A 249 ? ? -41.88 105.78 242 17 GLN A 254 ? ? -84.19 -129.97 243 17 ALA A 267 ? ? 76.23 -39.72 244 17 SER A 277 ? ? -128.24 -122.93 245 17 ALA A 279 ? ? -159.10 -44.06 246 17 ALA A 282 ? ? -177.93 -119.94 247 18 LYS A 210 ? ? -124.59 -158.79 248 18 SER A 212 ? ? -161.97 -116.40 249 18 THR A 213 ? ? 48.79 -152.66 250 18 PRO A 221 ? ? -66.29 36.26 251 18 ALA A 222 ? ? -159.36 82.31 252 18 LYS A 230 ? ? 71.93 110.06 253 18 HIS A 240 ? ? 77.13 -48.35 254 18 ASN A 249 ? ? -42.50 109.77 255 18 GLN A 254 ? ? -81.15 -127.41 256 18 CYS A 276 ? ? -153.61 51.25 257 18 SER A 277 ? ? -86.37 -123.55 258 18 ALA A 279 ? ? -161.62 -46.09 259 18 ASP A 281 ? ? -57.32 108.65 260 18 ALA A 282 ? ? -166.71 -122.29 261 19 LYS A 210 ? ? -164.56 -111.01 262 19 SER A 212 ? ? -174.82 -130.53 263 19 THR A 213 ? ? 54.35 179.81 264 19 PRO A 221 ? ? -65.31 31.54 265 19 ALA A 222 ? ? -153.45 86.89 266 19 LYS A 230 ? ? 69.36 109.66 267 19 HIS A 240 ? ? 76.45 -54.74 268 19 ASN A 249 ? ? -46.15 105.66 269 19 GLN A 254 ? ? -79.88 -133.59 270 19 GLN A 275 ? ? 57.13 73.17 271 19 CYS A 276 ? ? -157.54 48.37 272 19 SER A 277 ? ? -84.59 -134.36 273 19 ALA A 279 ? ? -152.74 -41.59 274 19 ALA A 282 ? ? -174.80 -110.25 275 20 SER A 212 ? ? -175.42 43.33 276 20 PRO A 221 ? ? -66.51 32.77 277 20 ALA A 222 ? ? -156.14 89.65 278 20 LYS A 230 ? ? 72.26 109.06 279 20 HIS A 240 ? ? 75.89 -57.81 280 20 ASP A 241 ? ? -111.64 56.57 281 20 ASN A 249 ? ? -45.71 106.57 282 20 GLN A 254 ? ? -78.17 -118.59 283 20 MET A 255 ? ? -171.94 131.46 284 20 SER A 256 ? ? -163.63 -150.72 285 20 SER A 258 ? ? 71.05 -65.67 286 20 GLN A 275 ? ? 60.80 60.14 287 20 CYS A 276 ? ? -153.78 55.24 288 20 SER A 277 ? ? -98.86 -127.56 289 20 ALA A 279 ? ? -154.05 -44.42 290 20 ASP A 281 ? ? -57.85 102.28 291 20 ALA A 282 ? ? -169.79 -107.60 292 21 LYS A 210 ? ? -126.47 -58.84 293 21 SER A 212 ? ? -169.90 -57.83 294 21 ALA A 214 ? ? -71.95 42.51 295 21 PRO A 221 ? ? -65.71 30.96 296 21 LYS A 230 ? ? 67.79 109.73 297 21 HIS A 240 ? ? 75.90 -47.84 298 21 ASN A 249 ? ? -43.24 104.42 299 21 GLN A 254 ? ? -83.87 -127.45 300 21 CYS A 276 ? ? -150.66 55.10 301 21 SER A 277 ? ? -82.08 -129.31 302 21 ALA A 279 ? ? -168.13 -49.59 303 21 ALA A 282 ? ? -175.92 -103.71 304 22 LYS A 210 ? ? -141.84 -57.39 305 22 SER A 212 ? ? -64.76 67.38 306 22 THR A 213 ? ? 39.34 -140.23 307 22 PRO A 221 ? ? -66.44 32.95 308 22 ALA A 222 ? ? -157.78 87.39 309 22 LYS A 230 ? ? 70.84 104.85 310 22 HIS A 240 ? ? 76.22 -76.19 311 22 ASP A 241 ? ? -100.62 42.51 312 22 ASN A 249 ? ? -44.14 109.28 313 22 GLN A 254 ? ? -87.81 -129.29 314 22 ALA A 267 ? ? 76.27 -37.72 315 22 GLN A 275 ? ? 58.70 76.83 316 22 CYS A 276 ? ? -162.45 117.45 317 22 SER A 277 ? ? -148.70 -139.26 318 22 LEU A 278 ? ? -71.59 49.59 319 22 ALA A 279 ? ? -161.84 -46.34 320 22 ALA A 282 ? ? -172.28 -119.44 321 23 LYS A 210 ? ? -136.82 -136.01 322 23 SER A 212 ? ? 160.97 -126.28 323 23 THR A 213 ? ? 56.17 14.00 324 23 PRO A 221 ? ? -66.47 35.66 325 23 ALA A 222 ? ? -159.99 86.35 326 23 LYS A 230 ? ? 69.87 104.37 327 23 HIS A 240 ? ? 75.67 -65.45 328 23 ASP A 241 ? ? -115.83 51.87 329 23 GLN A 254 ? ? -85.45 -134.65 330 23 SER A 258 ? ? -83.41 -81.35 331 23 ALA A 267 ? ? 74.19 -38.35 332 23 CYS A 276 ? ? -165.19 59.73 333 23 SER A 277 ? ? -109.85 -114.28 334 23 LEU A 278 ? ? -69.25 58.43 335 23 ALA A 279 ? ? -165.85 -46.29 336 23 ALA A 282 ? ? -168.57 -110.47 337 24 LYS A 210 ? ? -176.13 140.07 338 24 SER A 212 ? ? -167.10 -83.81 339 24 THR A 213 ? ? 45.97 -149.89 340 24 PRO A 221 ? ? -68.97 29.92 341 24 LYS A 230 ? ? 71.05 115.39 342 24 HIS A 240 ? ? 80.99 -57.53 343 24 ALA A 242 ? ? -30.07 137.99 344 24 ASN A 249 ? ? -45.08 107.82 345 24 SER A 256 ? ? -148.84 -152.31 346 24 SER A 258 ? ? -159.66 -56.24 347 24 ALA A 267 ? ? 75.92 -35.12 348 24 CYS A 276 ? ? -169.80 100.93 349 24 SER A 277 ? ? -164.62 -110.64 350 24 ALA A 279 ? ? -169.52 -45.44 351 24 ALA A 282 ? ? -169.08 -97.07 352 25 SER A 212 ? ? -160.94 -104.08 353 25 THR A 213 ? ? 47.92 -158.43 354 25 PRO A 221 ? ? -68.02 38.58 355 25 ALA A 222 ? ? -163.17 84.33 356 25 LYS A 230 ? ? 71.93 104.27 357 25 HIS A 240 ? ? 75.57 -52.66 358 25 ASN A 249 ? ? -44.00 107.55 359 25 GLN A 254 ? ? -93.49 -132.12 360 25 TYR A 260 ? ? 36.09 57.70 361 25 ALA A 267 ? ? 75.90 -37.84 362 25 GLN A 275 ? ? 65.32 77.31 363 25 SER A 277 ? ? -165.86 -142.62 364 25 ALA A 279 ? ? -145.03 -51.53 365 25 ALA A 282 ? ? -169.69 -122.57 366 26 SER A 212 ? ? -171.08 -103.81 367 26 THR A 213 ? ? 51.59 17.79 368 26 PRO A 221 ? ? -64.86 34.16 369 26 ALA A 222 ? ? -161.07 92.43 370 26 LYS A 230 ? ? 68.11 109.04 371 26 HIS A 240 ? ? 75.76 -56.87 372 26 ASP A 241 ? ? -108.90 42.15 373 26 ASN A 249 ? ? -37.53 102.84 374 26 SER A 256 ? ? -149.19 -152.01 375 26 SER A 258 ? ? -149.51 -57.75 376 26 ALA A 267 ? ? 77.46 -40.19 377 26 CYS A 276 ? ? -148.95 56.84 378 26 SER A 277 ? ? -88.99 -129.43 379 26 ALA A 279 ? ? -161.55 -43.57 380 26 ALA A 282 ? ? -174.48 -113.98 381 27 THR A 213 ? ? -67.45 -132.64 382 27 ALA A 214 ? ? -73.25 30.69 383 27 PRO A 221 ? ? -65.55 38.05 384 27 ALA A 222 ? ? -161.01 85.15 385 27 LYS A 230 ? ? 71.48 109.81 386 27 HIS A 240 ? ? 77.07 -68.48 387 27 ASN A 249 ? ? -42.30 109.86 388 27 GLN A 254 ? ? -88.64 -118.32 389 27 LYS A 259 ? ? 179.51 159.36 390 27 ALA A 267 ? ? 78.56 -44.09 391 27 GLN A 275 ? ? 62.24 62.14 392 27 CYS A 276 ? ? -161.84 114.44 393 27 SER A 277 ? ? -154.19 -134.81 394 27 LEU A 278 ? ? -73.17 41.54 395 27 ALA A 279 ? ? -150.31 -45.10 396 27 ALA A 282 ? ? -172.19 -108.65 397 28 SER A 212 ? ? -176.38 -114.87 398 28 PRO A 221 ? ? -64.72 27.93 399 28 LYS A 230 ? ? 67.74 113.20 400 28 HIS A 240 ? ? 77.04 -60.83 401 28 ASN A 249 ? ? -39.12 102.36 402 28 GLN A 254 ? ? -93.11 -128.05 403 28 SER A 258 ? ? -84.30 -73.98 404 28 GLN A 275 ? ? 58.46 72.12 405 28 CYS A 276 ? ? -151.98 45.10 406 28 SER A 277 ? ? -83.94 -134.09 407 28 ALA A 279 ? ? -173.68 -37.27 408 28 ALA A 282 ? ? -175.78 -111.90 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 TYR A 223 ? ? 0.052 'SIDE CHAIN' 2 11 TYR A 223 ? ? 0.058 'SIDE CHAIN' 3 23 TYR A 223 ? ? 0.057 'SIDE CHAIN' 4 24 TYR A 223 ? ? 0.062 'SIDE CHAIN' 5 25 TYR A 223 ? ? 0.053 'SIDE CHAIN' 6 28 TYR A 260 ? ? 0.052 'SIDE CHAIN' # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 4 SER A 226 ? ? 10.02 2 5 SER A 226 ? ? 10.08 3 6 SER A 226 ? ? 10.70 4 7 SER A 226 ? ? 10.21 5 10 SER A 226 ? ? 10.26 6 12 SER A 226 ? ? 10.86 7 15 VAL A 225 ? ? -10.00 8 15 SER A 226 ? ? 10.45 9 20 SER A 212 ? ? 11.36 10 20 SER A 226 ? ? 10.21 11 20 LYS A 245 ? ? 10.30 12 20 TRP A 246 ? ? 11.36 13 21 SER A 226 ? ? 10.52 14 22 TRP A 246 ? ? 10.23 15 24 CYS A 276 ? ? 10.44 16 25 SER A 226 ? ? 10.80 17 27 SER A 226 ? ? 10.19 18 27 TRP A 246 ? ? 10.16 # _pdbx_nmr_ensemble.entry_id 1PD6 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 28 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1PD6 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.75mM C2; 15N; 20mM phosphate buffer; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '0.75mM C2; 15N, 13C; 20mM phosphate buffer; 90% H2O, 10% D2O' '90% H2O/10% D2O' 3 '0.75mM C2; 15N, 13C; 20mM phosphate buffer; 100% D2O' '100% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 ambient 7.0 0.1 ? K 2 298 ambient 7.0 0.1 ? K 3 298 ambient 7.0 7.0 ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 2 3D_13C-separated_NOESY 3 3 3 3D_13C-separated_NOESY # _pdbx_nmr_details.entry_id 1PD6 _pdbx_nmr_details.text 'Further NMR experiments could be found in the BMRB accession number 5591' # _pdbx_nmr_refine.entry_id 1PD6 _pdbx_nmr_refine.method 'we have used ARIA protocols' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal ANSIG 3.3 'data analysis' 'Kraulis, J.' 1 ARIA 1.1 'structure solution' ;Linge, J., O'Donoghue, S., Nilges, M. ; 2 NMRPipe 290302 processing 'Delaglio, F., Grzesiek, S., Zhu, G., Vuister, G.W., Pfeifer, J., Bax, A.' 3 Azara 2.6 'data analysis' 'Boucher, W.' 4 ARIA 1.1 refinement ;Linge, J., O'Donoghue, S., Nilges, M. ; 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 198 ? A MET 1 2 1 Y 1 A HIS 199 ? A HIS 2 3 1 Y 1 A HIS 200 ? A HIS 3 4 1 Y 1 A HIS 201 ? A HIS 4 5 1 Y 1 A HIS 202 ? A HIS 5 6 1 Y 1 A HIS 203 ? A HIS 6 7 1 Y 1 A HIS 204 ? A HIS 7 8 1 Y 1 A SER 205 ? A SER 8 9 1 Y 1 A SER 206 ? A SER 9 10 1 Y 1 A MET 207 ? A MET 10 11 2 Y 1 A MET 198 ? A MET 1 12 2 Y 1 A HIS 199 ? A HIS 2 13 2 Y 1 A HIS 200 ? A HIS 3 14 2 Y 1 A HIS 201 ? A HIS 4 15 2 Y 1 A HIS 202 ? A HIS 5 16 2 Y 1 A HIS 203 ? A HIS 6 17 2 Y 1 A HIS 204 ? A HIS 7 18 2 Y 1 A SER 205 ? A SER 8 19 2 Y 1 A SER 206 ? A SER 9 20 2 Y 1 A MET 207 ? A MET 10 21 3 Y 1 A MET 198 ? A MET 1 22 3 Y 1 A HIS 199 ? A HIS 2 23 3 Y 1 A HIS 200 ? A HIS 3 24 3 Y 1 A HIS 201 ? A HIS 4 25 3 Y 1 A HIS 202 ? A HIS 5 26 3 Y 1 A HIS 203 ? A HIS 6 27 3 Y 1 A HIS 204 ? A HIS 7 28 3 Y 1 A SER 205 ? A SER 8 29 3 Y 1 A SER 206 ? A SER 9 30 3 Y 1 A MET 207 ? A MET 10 31 4 Y 1 A MET 198 ? A MET 1 32 4 Y 1 A HIS 199 ? A HIS 2 33 4 Y 1 A HIS 200 ? A HIS 3 34 4 Y 1 A HIS 201 ? A HIS 4 35 4 Y 1 A HIS 202 ? A HIS 5 36 4 Y 1 A HIS 203 ? A HIS 6 37 4 Y 1 A HIS 204 ? A HIS 7 38 4 Y 1 A SER 205 ? A SER 8 39 4 Y 1 A SER 206 ? A SER 9 40 4 Y 1 A MET 207 ? A MET 10 41 5 Y 1 A MET 198 ? A MET 1 42 5 Y 1 A HIS 199 ? A HIS 2 43 5 Y 1 A HIS 200 ? A HIS 3 44 5 Y 1 A HIS 201 ? A HIS 4 45 5 Y 1 A HIS 202 ? A HIS 5 46 5 Y 1 A HIS 203 ? A HIS 6 47 5 Y 1 A HIS 204 ? A HIS 7 48 5 Y 1 A SER 205 ? A SER 8 49 5 Y 1 A SER 206 ? A SER 9 50 5 Y 1 A MET 207 ? A MET 10 51 6 Y 1 A MET 198 ? A MET 1 52 6 Y 1 A HIS 199 ? A HIS 2 53 6 Y 1 A HIS 200 ? A HIS 3 54 6 Y 1 A HIS 201 ? A HIS 4 55 6 Y 1 A HIS 202 ? A HIS 5 56 6 Y 1 A HIS 203 ? A HIS 6 57 6 Y 1 A HIS 204 ? A HIS 7 58 6 Y 1 A SER 205 ? A SER 8 59 6 Y 1 A SER 206 ? A SER 9 60 6 Y 1 A MET 207 ? A MET 10 61 7 Y 1 A MET 198 ? A MET 1 62 7 Y 1 A HIS 199 ? A HIS 2 63 7 Y 1 A HIS 200 ? A HIS 3 64 7 Y 1 A HIS 201 ? A HIS 4 65 7 Y 1 A HIS 202 ? A HIS 5 66 7 Y 1 A HIS 203 ? A HIS 6 67 7 Y 1 A HIS 204 ? A HIS 7 68 7 Y 1 A SER 205 ? A SER 8 69 7 Y 1 A SER 206 ? A SER 9 70 7 Y 1 A MET 207 ? A MET 10 71 8 Y 1 A MET 198 ? A MET 1 72 8 Y 1 A HIS 199 ? A HIS 2 73 8 Y 1 A HIS 200 ? A HIS 3 74 8 Y 1 A HIS 201 ? A HIS 4 75 8 Y 1 A HIS 202 ? A HIS 5 76 8 Y 1 A HIS 203 ? A HIS 6 77 8 Y 1 A HIS 204 ? A HIS 7 78 8 Y 1 A SER 205 ? A SER 8 79 8 Y 1 A SER 206 ? A SER 9 80 8 Y 1 A MET 207 ? A MET 10 81 9 Y 1 A MET 198 ? A MET 1 82 9 Y 1 A HIS 199 ? A HIS 2 83 9 Y 1 A HIS 200 ? A HIS 3 84 9 Y 1 A HIS 201 ? A HIS 4 85 9 Y 1 A HIS 202 ? A HIS 5 86 9 Y 1 A HIS 203 ? A HIS 6 87 9 Y 1 A HIS 204 ? A HIS 7 88 9 Y 1 A SER 205 ? A SER 8 89 9 Y 1 A SER 206 ? A SER 9 90 9 Y 1 A MET 207 ? A MET 10 91 10 Y 1 A MET 198 ? A MET 1 92 10 Y 1 A HIS 199 ? A HIS 2 93 10 Y 1 A HIS 200 ? A HIS 3 94 10 Y 1 A HIS 201 ? A HIS 4 95 10 Y 1 A HIS 202 ? A HIS 5 96 10 Y 1 A HIS 203 ? A HIS 6 97 10 Y 1 A HIS 204 ? A HIS 7 98 10 Y 1 A SER 205 ? A SER 8 99 10 Y 1 A SER 206 ? A SER 9 100 10 Y 1 A MET 207 ? A MET 10 101 11 Y 1 A MET 198 ? A MET 1 102 11 Y 1 A HIS 199 ? A HIS 2 103 11 Y 1 A HIS 200 ? A HIS 3 104 11 Y 1 A HIS 201 ? A HIS 4 105 11 Y 1 A HIS 202 ? A HIS 5 106 11 Y 1 A HIS 203 ? A HIS 6 107 11 Y 1 A HIS 204 ? A HIS 7 108 11 Y 1 A SER 205 ? A SER 8 109 11 Y 1 A SER 206 ? A SER 9 110 11 Y 1 A MET 207 ? A MET 10 111 12 Y 1 A MET 198 ? A MET 1 112 12 Y 1 A HIS 199 ? A HIS 2 113 12 Y 1 A HIS 200 ? A HIS 3 114 12 Y 1 A HIS 201 ? A HIS 4 115 12 Y 1 A HIS 202 ? A HIS 5 116 12 Y 1 A HIS 203 ? A HIS 6 117 12 Y 1 A HIS 204 ? A HIS 7 118 12 Y 1 A SER 205 ? A SER 8 119 12 Y 1 A SER 206 ? A SER 9 120 12 Y 1 A MET 207 ? A MET 10 121 13 Y 1 A MET 198 ? A MET 1 122 13 Y 1 A HIS 199 ? A HIS 2 123 13 Y 1 A HIS 200 ? A HIS 3 124 13 Y 1 A HIS 201 ? A HIS 4 125 13 Y 1 A HIS 202 ? A HIS 5 126 13 Y 1 A HIS 203 ? A HIS 6 127 13 Y 1 A HIS 204 ? A HIS 7 128 13 Y 1 A SER 205 ? A SER 8 129 13 Y 1 A SER 206 ? A SER 9 130 13 Y 1 A MET 207 ? A MET 10 131 14 Y 1 A MET 198 ? A MET 1 132 14 Y 1 A HIS 199 ? A HIS 2 133 14 Y 1 A HIS 200 ? A HIS 3 134 14 Y 1 A HIS 201 ? A HIS 4 135 14 Y 1 A HIS 202 ? A HIS 5 136 14 Y 1 A HIS 203 ? A HIS 6 137 14 Y 1 A HIS 204 ? A HIS 7 138 14 Y 1 A SER 205 ? A SER 8 139 14 Y 1 A SER 206 ? A SER 9 140 14 Y 1 A MET 207 ? A MET 10 141 15 Y 1 A MET 198 ? A MET 1 142 15 Y 1 A HIS 199 ? A HIS 2 143 15 Y 1 A HIS 200 ? A HIS 3 144 15 Y 1 A HIS 201 ? A HIS 4 145 15 Y 1 A HIS 202 ? A HIS 5 146 15 Y 1 A HIS 203 ? A HIS 6 147 15 Y 1 A HIS 204 ? A HIS 7 148 15 Y 1 A SER 205 ? A SER 8 149 15 Y 1 A SER 206 ? A SER 9 150 15 Y 1 A MET 207 ? A MET 10 151 16 Y 1 A MET 198 ? A MET 1 152 16 Y 1 A HIS 199 ? A HIS 2 153 16 Y 1 A HIS 200 ? A HIS 3 154 16 Y 1 A HIS 201 ? A HIS 4 155 16 Y 1 A HIS 202 ? A HIS 5 156 16 Y 1 A HIS 203 ? A HIS 6 157 16 Y 1 A HIS 204 ? A HIS 7 158 16 Y 1 A SER 205 ? A SER 8 159 16 Y 1 A SER 206 ? A SER 9 160 16 Y 1 A MET 207 ? A MET 10 161 17 Y 1 A MET 198 ? A MET 1 162 17 Y 1 A HIS 199 ? A HIS 2 163 17 Y 1 A HIS 200 ? A HIS 3 164 17 Y 1 A HIS 201 ? A HIS 4 165 17 Y 1 A HIS 202 ? A HIS 5 166 17 Y 1 A HIS 203 ? A HIS 6 167 17 Y 1 A HIS 204 ? A HIS 7 168 17 Y 1 A SER 205 ? A SER 8 169 17 Y 1 A SER 206 ? A SER 9 170 17 Y 1 A MET 207 ? A MET 10 171 18 Y 1 A MET 198 ? A MET 1 172 18 Y 1 A HIS 199 ? A HIS 2 173 18 Y 1 A HIS 200 ? A HIS 3 174 18 Y 1 A HIS 201 ? A HIS 4 175 18 Y 1 A HIS 202 ? A HIS 5 176 18 Y 1 A HIS 203 ? A HIS 6 177 18 Y 1 A HIS 204 ? A HIS 7 178 18 Y 1 A SER 205 ? A SER 8 179 18 Y 1 A SER 206 ? A SER 9 180 18 Y 1 A MET 207 ? A MET 10 181 19 Y 1 A MET 198 ? A MET 1 182 19 Y 1 A HIS 199 ? A HIS 2 183 19 Y 1 A HIS 200 ? A HIS 3 184 19 Y 1 A HIS 201 ? A HIS 4 185 19 Y 1 A HIS 202 ? A HIS 5 186 19 Y 1 A HIS 203 ? A HIS 6 187 19 Y 1 A HIS 204 ? A HIS 7 188 19 Y 1 A SER 205 ? A SER 8 189 19 Y 1 A SER 206 ? A SER 9 190 19 Y 1 A MET 207 ? A MET 10 191 20 Y 1 A MET 198 ? A MET 1 192 20 Y 1 A HIS 199 ? A HIS 2 193 20 Y 1 A HIS 200 ? A HIS 3 194 20 Y 1 A HIS 201 ? A HIS 4 195 20 Y 1 A HIS 202 ? A HIS 5 196 20 Y 1 A HIS 203 ? A HIS 6 197 20 Y 1 A HIS 204 ? A HIS 7 198 20 Y 1 A SER 205 ? A SER 8 199 20 Y 1 A SER 206 ? A SER 9 200 20 Y 1 A MET 207 ? A MET 10 201 21 Y 1 A MET 198 ? A MET 1 202 21 Y 1 A HIS 199 ? A HIS 2 203 21 Y 1 A HIS 200 ? A HIS 3 204 21 Y 1 A HIS 201 ? A HIS 4 205 21 Y 1 A HIS 202 ? A HIS 5 206 21 Y 1 A HIS 203 ? A HIS 6 207 21 Y 1 A HIS 204 ? A HIS 7 208 21 Y 1 A SER 205 ? A SER 8 209 21 Y 1 A SER 206 ? A SER 9 210 21 Y 1 A MET 207 ? A MET 10 211 22 Y 1 A MET 198 ? A MET 1 212 22 Y 1 A HIS 199 ? A HIS 2 213 22 Y 1 A HIS 200 ? A HIS 3 214 22 Y 1 A HIS 201 ? A HIS 4 215 22 Y 1 A HIS 202 ? A HIS 5 216 22 Y 1 A HIS 203 ? A HIS 6 217 22 Y 1 A HIS 204 ? A HIS 7 218 22 Y 1 A SER 205 ? A SER 8 219 22 Y 1 A SER 206 ? A SER 9 220 22 Y 1 A MET 207 ? A MET 10 221 23 Y 1 A MET 198 ? A MET 1 222 23 Y 1 A HIS 199 ? A HIS 2 223 23 Y 1 A HIS 200 ? A HIS 3 224 23 Y 1 A HIS 201 ? A HIS 4 225 23 Y 1 A HIS 202 ? A HIS 5 226 23 Y 1 A HIS 203 ? A HIS 6 227 23 Y 1 A HIS 204 ? A HIS 7 228 23 Y 1 A SER 205 ? A SER 8 229 23 Y 1 A SER 206 ? A SER 9 230 23 Y 1 A MET 207 ? A MET 10 231 24 Y 1 A MET 198 ? A MET 1 232 24 Y 1 A HIS 199 ? A HIS 2 233 24 Y 1 A HIS 200 ? A HIS 3 234 24 Y 1 A HIS 201 ? A HIS 4 235 24 Y 1 A HIS 202 ? A HIS 5 236 24 Y 1 A HIS 203 ? A HIS 6 237 24 Y 1 A HIS 204 ? A HIS 7 238 24 Y 1 A SER 205 ? A SER 8 239 24 Y 1 A SER 206 ? A SER 9 240 24 Y 1 A MET 207 ? A MET 10 241 25 Y 1 A MET 198 ? A MET 1 242 25 Y 1 A HIS 199 ? A HIS 2 243 25 Y 1 A HIS 200 ? A HIS 3 244 25 Y 1 A HIS 201 ? A HIS 4 245 25 Y 1 A HIS 202 ? A HIS 5 246 25 Y 1 A HIS 203 ? A HIS 6 247 25 Y 1 A HIS 204 ? A HIS 7 248 25 Y 1 A SER 205 ? A SER 8 249 25 Y 1 A SER 206 ? A SER 9 250 25 Y 1 A MET 207 ? A MET 10 251 26 Y 1 A MET 198 ? A MET 1 252 26 Y 1 A HIS 199 ? A HIS 2 253 26 Y 1 A HIS 200 ? A HIS 3 254 26 Y 1 A HIS 201 ? A HIS 4 255 26 Y 1 A HIS 202 ? A HIS 5 256 26 Y 1 A HIS 203 ? A HIS 6 257 26 Y 1 A HIS 204 ? A HIS 7 258 26 Y 1 A SER 205 ? A SER 8 259 26 Y 1 A SER 206 ? A SER 9 260 26 Y 1 A MET 207 ? A MET 10 261 27 Y 1 A MET 198 ? A MET 1 262 27 Y 1 A HIS 199 ? A HIS 2 263 27 Y 1 A HIS 200 ? A HIS 3 264 27 Y 1 A HIS 201 ? A HIS 4 265 27 Y 1 A HIS 202 ? A HIS 5 266 27 Y 1 A HIS 203 ? A HIS 6 267 27 Y 1 A HIS 204 ? A HIS 7 268 27 Y 1 A SER 205 ? A SER 8 269 27 Y 1 A SER 206 ? A SER 9 270 27 Y 1 A MET 207 ? A MET 10 271 28 Y 1 A MET 198 ? A MET 1 272 28 Y 1 A HIS 199 ? A HIS 2 273 28 Y 1 A HIS 200 ? A HIS 3 274 28 Y 1 A HIS 201 ? A HIS 4 275 28 Y 1 A HIS 202 ? A HIS 5 276 28 Y 1 A HIS 203 ? A HIS 6 277 28 Y 1 A HIS 204 ? A HIS 7 278 28 Y 1 A SER 205 ? A SER 8 279 28 Y 1 A SER 206 ? A SER 9 280 28 Y 1 A MET 207 ? A MET 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 600 2 ? Bruker AVANCE 600 3 ? Varian UnityINOVA 800 # _atom_sites.entry_id 1PD6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_