data_1PI8 # _entry.id 1PI8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PI8 pdb_00001pi8 10.2210/pdb1pi8/pdb RCSB RCSB019337 ? ? WWPDB D_1000019337 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-11-11 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PI8 _pdbx_database_status.recvd_initial_deposition_date 2003-05-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1PI7 _pdbx_database_related.details 'Pentamer structure of channel-forming trans-membrane domain of Vpu' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Park, S.H.' 1 'Mrse, A.A.' 2 'Nevzorov, A.A.' 3 'Mesleh, M.F.' 4 'Oblatt-Montal, M.' 5 'Montal, M.' 6 'Opella, S.J.' 7 # _citation.id primary _citation.title ;Three-dimensional structure of the channel-forming trans-membrane domain of virus protein "u" (Vpu) from HIV-1 ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 333 _citation.page_first 409 _citation.page_last 424 _citation.year 2003 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14529626 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2003.08.048 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Park, S.H.' 1 ? primary 'Mrse, A.A.' 2 ? primary 'Nevzorov, A.A.' 3 ? primary 'Mesleh, M.F.' 4 ? primary 'Oblatt-Montal, M.' 5 ? primary 'Montal, M.' 6 ? primary 'Opella, S.J.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'VPU protein' _entity.formula_weight 3873.885 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation Y29G _entity.pdbx_fragment 'Trans-membrane domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'U ORF protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MQPIQIAIVALVVAIIIAIVVWSIVIIEGRGGKKKK _entity_poly.pdbx_seq_one_letter_code_can MQPIQIAIVALVVAIIIAIVVWSIVIIEGRGGKKKK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 PRO n 1 4 ILE n 1 5 GLN n 1 6 ILE n 1 7 ALA n 1 8 ILE n 1 9 VAL n 1 10 ALA n 1 11 LEU n 1 12 VAL n 1 13 VAL n 1 14 ALA n 1 15 ILE n 1 16 ILE n 1 17 ILE n 1 18 ALA n 1 19 ILE n 1 20 VAL n 1 21 VAL n 1 22 TRP n 1 23 SER n 1 24 ILE n 1 25 VAL n 1 26 ILE n 1 27 ILE n 1 28 GLU n 1 29 GLY n 1 30 ARG n 1 31 GLY n 1 32 GLY n 1 33 LYS n 1 34 LYS n 1 35 LYS n 1 36 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene VPU _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BLR(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-31b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLN 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 GLN 5 5 ? ? ? A . n A 1 6 ILE 6 6 ? ? ? A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ILE 26 26 ? ? ? A . n A 1 27 ILE 27 27 ? ? ? A . n A 1 28 GLU 28 28 ? ? ? A . n A 1 29 GLY 29 29 ? ? ? A . n A 1 30 ARG 30 30 ? ? ? A . n A 1 31 GLY 31 31 ? ? ? A . n A 1 32 GLY 32 32 ? ? ? A . n A 1 33 LYS 33 33 ? ? ? A . n A 1 34 LYS 34 34 ? ? ? A . n A 1 35 LYS 35 35 ? ? ? A . n A 1 36 LYS 36 36 ? ? ? A . n # _exptl.entry_id 1PI8 _exptl.method 'SOLID-STATE NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1PI8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1PI8 _struct.title ;Structure of the channel-forming trans-membrane domain of Virus protein "u" (Vpu) from HIV-1 ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PI8 _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'ALPHA HELIX, Viral protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VPU_HV1LW _struct_ref.pdbx_db_accession Q70625 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MQPIQIAIVALVVAIIIAIVVWSIVIIEYR _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PI8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q70625 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 30 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1PI8 GLY A 29 ? UNP Q70625 TYR 29 'engineered mutation' 29 1 1 1PI8 GLY A 31 ? UNP Q70625 ? ? 'cloning artifact' 31 2 1 1PI8 GLY A 32 ? UNP Q70625 ? ? 'cloning artifact' 32 3 1 1PI8 LYS A 33 ? UNP Q70625 ? ? 'cloning artifact' 33 4 1 1PI8 LYS A 34 ? UNP Q70625 ? ? 'cloning artifact' 34 5 1 1PI8 LYS A 35 ? UNP Q70625 ? ? 'cloning artifact' 35 6 1 1PI8 LYS A 36 ? UNP Q70625 ? ? 'cloning artifact' 36 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 7 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 7 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 25 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 24 ? ? HG23 A VAL 25 ? ? 1.30 2 1 O A LEU 11 ? ? H A ILE 15 ? ? 1.46 3 1 O A ALA 18 ? ? H A TRP 22 ? ? 1.49 4 1 O A VAL 13 ? ? HG13 A ILE 17 ? ? 1.54 5 2 O A ILE 24 ? ? HG23 A VAL 25 ? ? 1.30 6 2 O A LEU 11 ? ? H A ILE 15 ? ? 1.46 7 2 O A ALA 18 ? ? H A TRP 22 ? ? 1.49 8 2 O A VAL 13 ? ? HG13 A ILE 17 ? ? 1.54 9 3 O A ILE 24 ? ? HG23 A VAL 25 ? ? 1.30 10 3 O A LEU 11 ? ? H A ILE 15 ? ? 1.46 11 3 O A ALA 18 ? ? H A TRP 22 ? ? 1.49 12 3 O A VAL 13 ? ? HG13 A ILE 17 ? ? 1.54 13 4 O A ILE 24 ? ? HG23 A VAL 25 ? ? 1.30 14 4 O A LEU 11 ? ? H A ILE 15 ? ? 1.46 15 4 O A ALA 18 ? ? H A TRP 22 ? ? 1.49 16 4 O A VAL 13 ? ? HG13 A ILE 17 ? ? 1.54 # _pdbx_nmr_ensemble.entry_id 1PI8 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 4 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1PI8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'Completely aligned in glass plates: 3.5 mg Vpu2-30+ U-15N, 75 mg lipid mixture (DOPC:DOPG, 9:1)' _pdbx_nmr_sample_details.solvent_system NA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type PISEMA # _pdbx_nmr_details.entry_id 1PI8 _pdbx_nmr_details.text 'PISEMA: Polarization Inversion Spin Exchange at the Magic Angle' # _pdbx_nmr_refine.entry_id 1PI8 _pdbx_nmr_refine.method 'SCWRL 2.1' _pdbx_nmr_refine.details ;This structure was constructed as a symmetric tetramer of the Vpu2-30+ trans-membrane construct based on the empirical minimization of energy upon the addition of sidechains to a backbone structure that was generated from solid-state NMR data using the program SCWRL. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.1 processing 'Delaglio, F., Grzesiek, S., Vuister, G.W., Zhu, G., Pfeifer, J., Bax, A.' 1 SCRWL 2.1 refinement 'Bower, M.J., Cohen, F.E., Dunbrack Jr., R.L.' 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLN 2 ? A GLN 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A GLN 5 ? A GLN 5 6 1 Y 1 A ILE 6 ? A ILE 6 7 1 Y 1 A ILE 26 ? A ILE 26 8 1 Y 1 A ILE 27 ? A ILE 27 9 1 Y 1 A GLU 28 ? A GLU 28 10 1 Y 1 A GLY 29 ? A GLY 29 11 1 Y 1 A ARG 30 ? A ARG 30 12 1 Y 1 A GLY 31 ? A GLY 31 13 1 Y 1 A GLY 32 ? A GLY 32 14 1 Y 1 A LYS 33 ? A LYS 33 15 1 Y 1 A LYS 34 ? A LYS 34 16 1 Y 1 A LYS 35 ? A LYS 35 17 1 Y 1 A LYS 36 ? A LYS 36 18 2 Y 1 A MET 1 ? A MET 1 19 2 Y 1 A GLN 2 ? A GLN 2 20 2 Y 1 A PRO 3 ? A PRO 3 21 2 Y 1 A ILE 4 ? A ILE 4 22 2 Y 1 A GLN 5 ? A GLN 5 23 2 Y 1 A ILE 6 ? A ILE 6 24 2 Y 1 A ILE 26 ? A ILE 26 25 2 Y 1 A ILE 27 ? A ILE 27 26 2 Y 1 A GLU 28 ? A GLU 28 27 2 Y 1 A GLY 29 ? A GLY 29 28 2 Y 1 A ARG 30 ? A ARG 30 29 2 Y 1 A GLY 31 ? A GLY 31 30 2 Y 1 A GLY 32 ? A GLY 32 31 2 Y 1 A LYS 33 ? A LYS 33 32 2 Y 1 A LYS 34 ? A LYS 34 33 2 Y 1 A LYS 35 ? A LYS 35 34 2 Y 1 A LYS 36 ? A LYS 36 35 3 Y 1 A MET 1 ? A MET 1 36 3 Y 1 A GLN 2 ? A GLN 2 37 3 Y 1 A PRO 3 ? A PRO 3 38 3 Y 1 A ILE 4 ? A ILE 4 39 3 Y 1 A GLN 5 ? A GLN 5 40 3 Y 1 A ILE 6 ? A ILE 6 41 3 Y 1 A ILE 26 ? A ILE 26 42 3 Y 1 A ILE 27 ? A ILE 27 43 3 Y 1 A GLU 28 ? A GLU 28 44 3 Y 1 A GLY 29 ? A GLY 29 45 3 Y 1 A ARG 30 ? A ARG 30 46 3 Y 1 A GLY 31 ? A GLY 31 47 3 Y 1 A GLY 32 ? A GLY 32 48 3 Y 1 A LYS 33 ? A LYS 33 49 3 Y 1 A LYS 34 ? A LYS 34 50 3 Y 1 A LYS 35 ? A LYS 35 51 3 Y 1 A LYS 36 ? A LYS 36 52 4 Y 1 A MET 1 ? A MET 1 53 4 Y 1 A GLN 2 ? A GLN 2 54 4 Y 1 A PRO 3 ? A PRO 3 55 4 Y 1 A ILE 4 ? A ILE 4 56 4 Y 1 A GLN 5 ? A GLN 5 57 4 Y 1 A ILE 6 ? A ILE 6 58 4 Y 1 A ILE 26 ? A ILE 26 59 4 Y 1 A ILE 27 ? A ILE 27 60 4 Y 1 A GLU 28 ? A GLU 28 61 4 Y 1 A GLY 29 ? A GLY 29 62 4 Y 1 A ARG 30 ? A ARG 30 63 4 Y 1 A GLY 31 ? A GLY 31 64 4 Y 1 A GLY 32 ? A GLY 32 65 4 Y 1 A LYS 33 ? A LYS 33 66 4 Y 1 A LYS 34 ? A LYS 34 67 4 Y 1 A LYS 35 ? A LYS 35 68 4 Y 1 A LYS 36 ? A LYS 36 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 GLN N N N N 41 GLN CA C N S 42 GLN C C N N 43 GLN O O N N 44 GLN CB C N N 45 GLN CG C N N 46 GLN CD C N N 47 GLN OE1 O N N 48 GLN NE2 N N N 49 GLN OXT O N N 50 GLN H H N N 51 GLN H2 H N N 52 GLN HA H N N 53 GLN HB2 H N N 54 GLN HB3 H N N 55 GLN HG2 H N N 56 GLN HG3 H N N 57 GLN HE21 H N N 58 GLN HE22 H N N 59 GLN HXT H N N 60 GLU N N N N 61 GLU CA C N S 62 GLU C C N N 63 GLU O O N N 64 GLU CB C N N 65 GLU CG C N N 66 GLU CD C N N 67 GLU OE1 O N N 68 GLU OE2 O N N 69 GLU OXT O N N 70 GLU H H N N 71 GLU H2 H N N 72 GLU HA H N N 73 GLU HB2 H N N 74 GLU HB3 H N N 75 GLU HG2 H N N 76 GLU HG3 H N N 77 GLU HE2 H N N 78 GLU HXT H N N 79 GLY N N N N 80 GLY CA C N N 81 GLY C C N N 82 GLY O O N N 83 GLY OXT O N N 84 GLY H H N N 85 GLY H2 H N N 86 GLY HA2 H N N 87 GLY HA3 H N N 88 GLY HXT H N N 89 ILE N N N N 90 ILE CA C N S 91 ILE C C N N 92 ILE O O N N 93 ILE CB C N S 94 ILE CG1 C N N 95 ILE CG2 C N N 96 ILE CD1 C N N 97 ILE OXT O N N 98 ILE H H N N 99 ILE H2 H N N 100 ILE HA H N N 101 ILE HB H N N 102 ILE HG12 H N N 103 ILE HG13 H N N 104 ILE HG21 H N N 105 ILE HG22 H N N 106 ILE HG23 H N N 107 ILE HD11 H N N 108 ILE HD12 H N N 109 ILE HD13 H N N 110 ILE HXT H N N 111 LEU N N N N 112 LEU CA C N S 113 LEU C C N N 114 LEU O O N N 115 LEU CB C N N 116 LEU CG C N N 117 LEU CD1 C N N 118 LEU CD2 C N N 119 LEU OXT O N N 120 LEU H H N N 121 LEU H2 H N N 122 LEU HA H N N 123 LEU HB2 H N N 124 LEU HB3 H N N 125 LEU HG H N N 126 LEU HD11 H N N 127 LEU HD12 H N N 128 LEU HD13 H N N 129 LEU HD21 H N N 130 LEU HD22 H N N 131 LEU HD23 H N N 132 LEU HXT H N N 133 LYS N N N N 134 LYS CA C N S 135 LYS C C N N 136 LYS O O N N 137 LYS CB C N N 138 LYS CG C N N 139 LYS CD C N N 140 LYS CE C N N 141 LYS NZ N N N 142 LYS OXT O N N 143 LYS H H N N 144 LYS H2 H N N 145 LYS HA H N N 146 LYS HB2 H N N 147 LYS HB3 H N N 148 LYS HG2 H N N 149 LYS HG3 H N N 150 LYS HD2 H N N 151 LYS HD3 H N N 152 LYS HE2 H N N 153 LYS HE3 H N N 154 LYS HZ1 H N N 155 LYS HZ2 H N N 156 LYS HZ3 H N N 157 LYS HXT H N N 158 MET N N N N 159 MET CA C N S 160 MET C C N N 161 MET O O N N 162 MET CB C N N 163 MET CG C N N 164 MET SD S N N 165 MET CE C N N 166 MET OXT O N N 167 MET H H N N 168 MET H2 H N N 169 MET HA H N N 170 MET HB2 H N N 171 MET HB3 H N N 172 MET HG2 H N N 173 MET HG3 H N N 174 MET HE1 H N N 175 MET HE2 H N N 176 MET HE3 H N N 177 MET HXT H N N 178 PRO N N N N 179 PRO CA C N S 180 PRO C C N N 181 PRO O O N N 182 PRO CB C N N 183 PRO CG C N N 184 PRO CD C N N 185 PRO OXT O N N 186 PRO H H N N 187 PRO HA H N N 188 PRO HB2 H N N 189 PRO HB3 H N N 190 PRO HG2 H N N 191 PRO HG3 H N N 192 PRO HD2 H N N 193 PRO HD3 H N N 194 PRO HXT H N N 195 SER N N N N 196 SER CA C N S 197 SER C C N N 198 SER O O N N 199 SER CB C N N 200 SER OG O N N 201 SER OXT O N N 202 SER H H N N 203 SER H2 H N N 204 SER HA H N N 205 SER HB2 H N N 206 SER HB3 H N N 207 SER HG H N N 208 SER HXT H N N 209 TRP N N N N 210 TRP CA C N S 211 TRP C C N N 212 TRP O O N N 213 TRP CB C N N 214 TRP CG C Y N 215 TRP CD1 C Y N 216 TRP CD2 C Y N 217 TRP NE1 N Y N 218 TRP CE2 C Y N 219 TRP CE3 C Y N 220 TRP CZ2 C Y N 221 TRP CZ3 C Y N 222 TRP CH2 C Y N 223 TRP OXT O N N 224 TRP H H N N 225 TRP H2 H N N 226 TRP HA H N N 227 TRP HB2 H N N 228 TRP HB3 H N N 229 TRP HD1 H N N 230 TRP HE1 H N N 231 TRP HE3 H N N 232 TRP HZ2 H N N 233 TRP HZ3 H N N 234 TRP HH2 H N N 235 TRP HXT H N N 236 TYR N N N N 237 TYR CA C N S 238 TYR C C N N 239 TYR O O N N 240 TYR CB C N N 241 TYR CG C Y N 242 TYR CD1 C Y N 243 TYR CD2 C Y N 244 TYR CE1 C Y N 245 TYR CE2 C Y N 246 TYR CZ C Y N 247 TYR OH O N N 248 TYR OXT O N N 249 TYR H H N N 250 TYR H2 H N N 251 TYR HA H N N 252 TYR HB2 H N N 253 TYR HB3 H N N 254 TYR HD1 H N N 255 TYR HD2 H N N 256 TYR HE1 H N N 257 TYR HE2 H N N 258 TYR HH H N N 259 TYR HXT H N N 260 VAL N N N N 261 VAL CA C N S 262 VAL C C N N 263 VAL O O N N 264 VAL CB C N N 265 VAL CG1 C N N 266 VAL CG2 C N N 267 VAL OXT O N N 268 VAL H H N N 269 VAL H2 H N N 270 VAL HA H N N 271 VAL HB H N N 272 VAL HG11 H N N 273 VAL HG12 H N N 274 VAL HG13 H N N 275 VAL HG21 H N N 276 VAL HG22 H N N 277 VAL HG23 H N N 278 VAL HXT H N N 279 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 GLN N CA sing N N 39 GLN N H sing N N 40 GLN N H2 sing N N 41 GLN CA C sing N N 42 GLN CA CB sing N N 43 GLN CA HA sing N N 44 GLN C O doub N N 45 GLN C OXT sing N N 46 GLN CB CG sing N N 47 GLN CB HB2 sing N N 48 GLN CB HB3 sing N N 49 GLN CG CD sing N N 50 GLN CG HG2 sing N N 51 GLN CG HG3 sing N N 52 GLN CD OE1 doub N N 53 GLN CD NE2 sing N N 54 GLN NE2 HE21 sing N N 55 GLN NE2 HE22 sing N N 56 GLN OXT HXT sing N N 57 GLU N CA sing N N 58 GLU N H sing N N 59 GLU N H2 sing N N 60 GLU CA C sing N N 61 GLU CA CB sing N N 62 GLU CA HA sing N N 63 GLU C O doub N N 64 GLU C OXT sing N N 65 GLU CB CG sing N N 66 GLU CB HB2 sing N N 67 GLU CB HB3 sing N N 68 GLU CG CD sing N N 69 GLU CG HG2 sing N N 70 GLU CG HG3 sing N N 71 GLU CD OE1 doub N N 72 GLU CD OE2 sing N N 73 GLU OE2 HE2 sing N N 74 GLU OXT HXT sing N N 75 GLY N CA sing N N 76 GLY N H sing N N 77 GLY N H2 sing N N 78 GLY CA C sing N N 79 GLY CA HA2 sing N N 80 GLY CA HA3 sing N N 81 GLY C O doub N N 82 GLY C OXT sing N N 83 GLY OXT HXT sing N N 84 ILE N CA sing N N 85 ILE N H sing N N 86 ILE N H2 sing N N 87 ILE CA C sing N N 88 ILE CA CB sing N N 89 ILE CA HA sing N N 90 ILE C O doub N N 91 ILE C OXT sing N N 92 ILE CB CG1 sing N N 93 ILE CB CG2 sing N N 94 ILE CB HB sing N N 95 ILE CG1 CD1 sing N N 96 ILE CG1 HG12 sing N N 97 ILE CG1 HG13 sing N N 98 ILE CG2 HG21 sing N N 99 ILE CG2 HG22 sing N N 100 ILE CG2 HG23 sing N N 101 ILE CD1 HD11 sing N N 102 ILE CD1 HD12 sing N N 103 ILE CD1 HD13 sing N N 104 ILE OXT HXT sing N N 105 LEU N CA sing N N 106 LEU N H sing N N 107 LEU N H2 sing N N 108 LEU CA C sing N N 109 LEU CA CB sing N N 110 LEU CA HA sing N N 111 LEU C O doub N N 112 LEU C OXT sing N N 113 LEU CB CG sing N N 114 LEU CB HB2 sing N N 115 LEU CB HB3 sing N N 116 LEU CG CD1 sing N N 117 LEU CG CD2 sing N N 118 LEU CG HG sing N N 119 LEU CD1 HD11 sing N N 120 LEU CD1 HD12 sing N N 121 LEU CD1 HD13 sing N N 122 LEU CD2 HD21 sing N N 123 LEU CD2 HD22 sing N N 124 LEU CD2 HD23 sing N N 125 LEU OXT HXT sing N N 126 LYS N CA sing N N 127 LYS N H sing N N 128 LYS N H2 sing N N 129 LYS CA C sing N N 130 LYS CA CB sing N N 131 LYS CA HA sing N N 132 LYS C O doub N N 133 LYS C OXT sing N N 134 LYS CB CG sing N N 135 LYS CB HB2 sing N N 136 LYS CB HB3 sing N N 137 LYS CG CD sing N N 138 LYS CG HG2 sing N N 139 LYS CG HG3 sing N N 140 LYS CD CE sing N N 141 LYS CD HD2 sing N N 142 LYS CD HD3 sing N N 143 LYS CE NZ sing N N 144 LYS CE HE2 sing N N 145 LYS CE HE3 sing N N 146 LYS NZ HZ1 sing N N 147 LYS NZ HZ2 sing N N 148 LYS NZ HZ3 sing N N 149 LYS OXT HXT sing N N 150 MET N CA sing N N 151 MET N H sing N N 152 MET N H2 sing N N 153 MET CA C sing N N 154 MET CA CB sing N N 155 MET CA HA sing N N 156 MET C O doub N N 157 MET C OXT sing N N 158 MET CB CG sing N N 159 MET CB HB2 sing N N 160 MET CB HB3 sing N N 161 MET CG SD sing N N 162 MET CG HG2 sing N N 163 MET CG HG3 sing N N 164 MET SD CE sing N N 165 MET CE HE1 sing N N 166 MET CE HE2 sing N N 167 MET CE HE3 sing N N 168 MET OXT HXT sing N N 169 PRO N CA sing N N 170 PRO N CD sing N N 171 PRO N H sing N N 172 PRO CA C sing N N 173 PRO CA CB sing N N 174 PRO CA HA sing N N 175 PRO C O doub N N 176 PRO C OXT sing N N 177 PRO CB CG sing N N 178 PRO CB HB2 sing N N 179 PRO CB HB3 sing N N 180 PRO CG CD sing N N 181 PRO CG HG2 sing N N 182 PRO CG HG3 sing N N 183 PRO CD HD2 sing N N 184 PRO CD HD3 sing N N 185 PRO OXT HXT sing N N 186 SER N CA sing N N 187 SER N H sing N N 188 SER N H2 sing N N 189 SER CA C sing N N 190 SER CA CB sing N N 191 SER CA HA sing N N 192 SER C O doub N N 193 SER C OXT sing N N 194 SER CB OG sing N N 195 SER CB HB2 sing N N 196 SER CB HB3 sing N N 197 SER OG HG sing N N 198 SER OXT HXT sing N N 199 TRP N CA sing N N 200 TRP N H sing N N 201 TRP N H2 sing N N 202 TRP CA C sing N N 203 TRP CA CB sing N N 204 TRP CA HA sing N N 205 TRP C O doub N N 206 TRP C OXT sing N N 207 TRP CB CG sing N N 208 TRP CB HB2 sing N N 209 TRP CB HB3 sing N N 210 TRP CG CD1 doub Y N 211 TRP CG CD2 sing Y N 212 TRP CD1 NE1 sing Y N 213 TRP CD1 HD1 sing N N 214 TRP CD2 CE2 doub Y N 215 TRP CD2 CE3 sing Y N 216 TRP NE1 CE2 sing Y N 217 TRP NE1 HE1 sing N N 218 TRP CE2 CZ2 sing Y N 219 TRP CE3 CZ3 doub Y N 220 TRP CE3 HE3 sing N N 221 TRP CZ2 CH2 doub Y N 222 TRP CZ2 HZ2 sing N N 223 TRP CZ3 CH2 sing Y N 224 TRP CZ3 HZ3 sing N N 225 TRP CH2 HH2 sing N N 226 TRP OXT HXT sing N N 227 TYR N CA sing N N 228 TYR N H sing N N 229 TYR N H2 sing N N 230 TYR CA C sing N N 231 TYR CA CB sing N N 232 TYR CA HA sing N N 233 TYR C O doub N N 234 TYR C OXT sing N N 235 TYR CB CG sing N N 236 TYR CB HB2 sing N N 237 TYR CB HB3 sing N N 238 TYR CG CD1 doub Y N 239 TYR CG CD2 sing Y N 240 TYR CD1 CE1 sing Y N 241 TYR CD1 HD1 sing N N 242 TYR CD2 CE2 doub Y N 243 TYR CD2 HD2 sing N N 244 TYR CE1 CZ doub Y N 245 TYR CE1 HE1 sing N N 246 TYR CE2 CZ sing Y N 247 TYR CE2 HE2 sing N N 248 TYR CZ OH sing N N 249 TYR OH HH sing N N 250 TYR OXT HXT sing N N 251 VAL N CA sing N N 252 VAL N H sing N N 253 VAL N H2 sing N N 254 VAL CA C sing N N 255 VAL CA CB sing N N 256 VAL CA HA sing N N 257 VAL C O doub N N 258 VAL C OXT sing N N 259 VAL CB CG1 sing N N 260 VAL CB CG2 sing N N 261 VAL CB HB sing N N 262 VAL CG1 HG11 sing N N 263 VAL CG1 HG12 sing N N 264 VAL CG1 HG13 sing N N 265 VAL CG2 HG21 sing N N 266 VAL CG2 HG22 sing N N 267 VAL CG2 HG23 sing N N 268 VAL OXT HXT sing N N 269 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 700 # _atom_sites.entry_id 1PI8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_