data_1PIR # _entry.id 1PIR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PIR pdb_00001pir 10.2210/pdb1pir/pdb WWPDB D_1000175703 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1PIS _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PIR _pdbx_database_status.recvd_initial_deposition_date 1994-12-22 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Van Den Berg, B.D.' 1 'Tessari, M.' 2 'De Haas, G.H.' 3 'Verheij, H.M.' 4 'Boelens, R.' 5 'Kaptein, R.' 6 # _citation.id primary _citation.title 'Solution structure of porcine pancreatic phospholipase A2.' _citation.journal_abbrev 'EMBO J.' _citation.journal_volume 14 _citation.page_first 4123 _citation.page_last 4131 _citation.year 1995 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 7556053 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'van den Berg, B.' 1 ? primary 'Tessari, M.' 2 ? primary 'de Haas, G.H.' 3 ? primary 'Verheij, H.M.' 4 ? primary 'Boelens, R.' 5 ? primary 'Kaptein, R.' 6 ? # _cell.entry_id 1PIR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PIR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PHOSPHOLIPASE A2' 14009.714 1 3.1.1.4 ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNT EITCNSKNNACEAFICNCDRNAAICFSKAPYNKEHKNLDTKKYC ; _entity_poly.pdbx_seq_one_letter_code_can ;ALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNT EITCNSKNNACEAFICNCDRNAAICFSKAPYNKEHKNLDTKKYC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LEU n 1 3 TRP n 1 4 GLN n 1 5 PHE n 1 6 ARG n 1 7 SER n 1 8 MET n 1 9 ILE n 1 10 LYS n 1 11 CYS n 1 12 ALA n 1 13 ILE n 1 14 PRO n 1 15 GLY n 1 16 SER n 1 17 HIS n 1 18 PRO n 1 19 LEU n 1 20 MET n 1 21 ASP n 1 22 PHE n 1 23 ASN n 1 24 ASN n 1 25 TYR n 1 26 GLY n 1 27 CYS n 1 28 TYR n 1 29 CYS n 1 30 GLY n 1 31 LEU n 1 32 GLY n 1 33 GLY n 1 34 SER n 1 35 GLY n 1 36 THR n 1 37 PRO n 1 38 VAL n 1 39 ASP n 1 40 GLU n 1 41 LEU n 1 42 ASP n 1 43 ARG n 1 44 CYS n 1 45 CYS n 1 46 GLU n 1 47 THR n 1 48 HIS n 1 49 ASP n 1 50 ASN n 1 51 CYS n 1 52 TYR n 1 53 ARG n 1 54 ASP n 1 55 ALA n 1 56 LYS n 1 57 ASN n 1 58 LEU n 1 59 ASP n 1 60 SER n 1 61 CYS n 1 62 LYS n 1 63 PHE n 1 64 LEU n 1 65 VAL n 1 66 ASP n 1 67 ASN n 1 68 PRO n 1 69 TYR n 1 70 THR n 1 71 GLU n 1 72 SER n 1 73 TYR n 1 74 SER n 1 75 TYR n 1 76 SER n 1 77 CYS n 1 78 SER n 1 79 ASN n 1 80 THR n 1 81 GLU n 1 82 ILE n 1 83 THR n 1 84 CYS n 1 85 ASN n 1 86 SER n 1 87 LYS n 1 88 ASN n 1 89 ASN n 1 90 ALA n 1 91 CYS n 1 92 GLU n 1 93 ALA n 1 94 PHE n 1 95 ILE n 1 96 CYS n 1 97 ASN n 1 98 CYS n 1 99 ASP n 1 100 ARG n 1 101 ASN n 1 102 ALA n 1 103 ALA n 1 104 ILE n 1 105 CYS n 1 106 PHE n 1 107 SER n 1 108 LYS n 1 109 ALA n 1 110 PRO n 1 111 TYR n 1 112 ASN n 1 113 LYS n 1 114 GLU n 1 115 HIS n 1 116 LYS n 1 117 ASN n 1 118 LEU n 1 119 ASP n 1 120 THR n 1 121 LYS n 1 122 LYS n 1 123 TYR n 1 124 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name pig _entity_src_gen.gene_src_genus Sus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sus scrofa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ PANCREAS _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PA21B_PIG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00592 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKFLVLAVLLTVGAAQEGISSRALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDNCYRDAKNL DSCKFLVDNPYTESYSYSCSNTEITCNSKNNACEAFICNCDRNAAICFSKAPYNKEHKNLDTKKYC ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PIR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00592 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1PIR _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1PIR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1PIR _struct.title 'SOLUTION STRUCTURE OF PORCINE PANCREATIC PHOSPHOLIPASE A2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PIR _struct_keywords.pdbx_keywords 'CARBOXYLIC ESTER HYDROLASE' _struct_keywords.text 'PHOSPHOLIPASE A2, PHOSPHATIDE-2-ACYL-HYDROLASE, PLA2, CARBOXYLIC ESTER HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 4 ? CYS A 11 ? GLN A 4 CYS A 11 1 ? 8 HELX_P HELX_P2 2 LEU A 19 ? PHE A 22 ? LEU A 19 PHE A 22 1 ? 4 HELX_P HELX_P3 3 GLU A 40 ? LYS A 56 ? GLU A 40 LYS A 56 1 ? 17 HELX_P HELX_P4 4 CYS A 91 ? LYS A 108 ? CYS A 91 LYS A 108 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 77 SG ? ? A CYS 11 A CYS 77 1_555 ? ? ? ? ? ? ? 1.982 ? ? disulf2 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 124 SG ? ? A CYS 27 A CYS 124 1_555 ? ? ? ? ? ? ? 2.006 ? ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 29 A CYS 45 1_555 ? ? ? ? ? ? ? 2.005 ? ? disulf4 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 105 SG ? ? A CYS 44 A CYS 105 1_555 ? ? ? ? ? ? ? 1.998 ? ? disulf5 disulf ? ? A CYS 51 SG ? ? ? 1_555 A CYS 98 SG ? ? A CYS 51 A CYS 98 1_555 ? ? ? ? ? ? ? 1.979 ? ? disulf6 disulf ? ? A CYS 61 SG ? ? ? 1_555 A CYS 91 SG ? ? A CYS 61 A CYS 91 1_555 ? ? ? ? ? ? ? 1.990 ? ? disulf7 disulf ? ? A CYS 84 SG ? ? ? 1_555 A CYS 96 SG ? ? A CYS 84 A CYS 96 1_555 ? ? ? ? ? ? ? 1.990 ? ? metalc1 metalc ? ? A TYR 28 O ? ? ? 1_555 B CA . CA ? ? A TYR 28 A CA 125 1_555 ? ? ? ? ? ? ? 3.021 ? ? metalc2 metalc ? ? A GLY 30 O ? ? ? 1_555 B CA . CA ? ? A GLY 30 A CA 125 1_555 ? ? ? ? ? ? ? 3.083 ? ? metalc3 metalc ? ? A GLY 32 O ? ? ? 1_555 B CA . CA ? ? A GLY 32 A CA 125 1_555 ? ? ? ? ? ? ? 3.052 ? ? metalc4 metalc ? ? A ASP 49 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 49 A CA 125 1_555 ? ? ? ? ? ? ? 3.096 ? ? metalc5 metalc ? ? A ASP 49 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 49 A CA 125 1_555 ? ? ? ? ? ? ? 3.036 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 125 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 125' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 TYR A 28 ? TYR A 28 . ? 1_555 ? 2 AC1 4 GLY A 30 ? GLY A 30 . ? 1_555 ? 3 AC1 4 GLY A 32 ? GLY A 32 . ? 1_555 ? 4 AC1 4 ASP A 49 ? ASP A 49 . ? 1_555 ? # _database_PDB_matrix.entry_id 1PIR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PIR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'GLN 4 - PHE 5 OMEGA = 149.05 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 2 'GLY 33 - SER 34 OMEGA = 213.60 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 3 'SER 34 - GLY 35 OMEGA = 143.57 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 4 'GLY 35 - THR 36 OMEGA = 138.96 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 5 'VAL 38 - ASP 39 OMEGA = 141.85 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 6 'LEU 41 - ASP 42 OMEGA = 136.97 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 7 'ASN 57 - LEU 58 OMEGA = 223.69 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 8 'PHE 63 - LEU 64 OMEGA = 114.86 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 9 'GLU 71 - SER 72 OMEGA = 213.52 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 10 ;CYS 77 - SER 78 OMEGA = 31.78 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION RESIDUE CYS 77 IS A CIS-PEPTIDE IN THE AVERAGED STRUCTURE. ; 11 'ASN 79 - THR 80 OMEGA = 102.43 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 12 'ASN 85 - SER 86 OMEGA = 219.82 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 13 'SER 86 - LYS 87 OMEGA = 140.98 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 14 'ASN 101 - ALA 102 OMEGA = 145.60 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 15 'ALA 109 - PRO 110 OMEGA = 140.10 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 16 'LYS 113 - GLU 114 OMEGA = 232.35 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 17 'LYS 116 - ASN 117 OMEGA = 144.31 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 18 'ASN 117 - LEU 118 OMEGA = 213.10 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 19 'ASP 119 - THR 120 OMEGA = 226.20 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 20 'THR 120 - LYS 121 OMEGA = 123.21 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 TRP 3 3 3 TRP TRP A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 CYS 124 124 124 CYS CYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 125 _pdbx_nonpoly_scheme.auth_seq_num 125 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A TYR 28 ? A TYR 28 ? 1_555 CA ? B CA . ? A CA 125 ? 1_555 O ? A GLY 30 ? A GLY 30 ? 1_555 112.7 ? 2 O ? A TYR 28 ? A TYR 28 ? 1_555 CA ? B CA . ? A CA 125 ? 1_555 O ? A GLY 32 ? A GLY 32 ? 1_555 108.6 ? 3 O ? A GLY 30 ? A GLY 30 ? 1_555 CA ? B CA . ? A CA 125 ? 1_555 O ? A GLY 32 ? A GLY 32 ? 1_555 137.2 ? 4 O ? A TYR 28 ? A TYR 28 ? 1_555 CA ? B CA . ? A CA 125 ? 1_555 OD1 ? A ASP 49 ? A ASP 49 ? 1_555 97.6 ? 5 O ? A GLY 30 ? A GLY 30 ? 1_555 CA ? B CA . ? A CA 125 ? 1_555 OD1 ? A ASP 49 ? A ASP 49 ? 1_555 82.9 ? 6 O ? A GLY 32 ? A GLY 32 ? 1_555 CA ? B CA . ? A CA 125 ? 1_555 OD1 ? A ASP 49 ? A ASP 49 ? 1_555 81.0 ? 7 O ? A TYR 28 ? A TYR 28 ? 1_555 CA ? B CA . ? A CA 125 ? 1_555 OD2 ? A ASP 49 ? A ASP 49 ? 1_555 64.6 ? 8 O ? A GLY 30 ? A GLY 30 ? 1_555 CA ? B CA . ? A CA 125 ? 1_555 OD2 ? A ASP 49 ? A ASP 49 ? 1_555 72.3 ? 9 O ? A GLY 32 ? A GLY 32 ? 1_555 CA ? B CA . ? A CA 125 ? 1_555 OD2 ? A ASP 49 ? A ASP 49 ? 1_555 117.9 ? 10 OD1 ? A ASP 49 ? A ASP 49 ? 1_555 CA ? B CA . ? A CA 125 ? 1_555 OD2 ? A ASP 49 ? A ASP 49 ? 1_555 43.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-06-03 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.value' 9 4 'Structure model' '_struct_conn.pdbx_dist_value' 10 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 16 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 22 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 23 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 24 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 40 ? ? OE1 A GLU 40 ? ? 1.372 1.252 0.120 0.011 N 2 1 CD A GLU 46 ? ? OE1 A GLU 46 ? ? 1.370 1.252 0.118 0.011 N 3 1 CD A GLU 71 ? ? OE1 A GLU 71 ? ? 1.372 1.252 0.120 0.011 N 4 1 CD A GLU 81 ? ? OE1 A GLU 81 ? ? 1.371 1.252 0.119 0.011 N 5 1 CD A GLU 92 ? ? OE2 A GLU 92 ? ? 1.371 1.252 0.119 0.011 N 6 1 CD A GLU 114 ? ? OE2 A GLU 114 ? ? 1.372 1.252 0.120 0.011 N 7 1 C A CYS 124 ? ? OXT A CYS 124 ? ? 1.372 1.229 0.143 0.019 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TRP 3 ? ? CG A TRP 3 ? ? CD2 A TRP 3 ? ? 136.69 126.60 10.09 1.30 N 2 1 CB A TRP 3 ? ? CG A TRP 3 ? ? CD1 A TRP 3 ? ? 116.35 127.00 -10.65 1.30 N 3 1 CD1 A TRP 3 ? ? NE1 A TRP 3 ? ? CE2 A TRP 3 ? ? 103.52 109.00 -5.48 0.90 N 4 1 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.94 120.30 3.64 0.50 N 5 1 CA A ILE 9 ? ? CB A ILE 9 ? ? CG1 A ILE 9 ? ? 122.61 111.00 11.61 1.90 N 6 1 ND1 A HIS 17 ? ? CE1 A HIS 17 ? ? NE2 A HIS 17 ? ? 120.32 111.50 8.82 1.30 N 7 1 CB A ASP 21 ? ? CG A ASP 21 ? ? OD1 A ASP 21 ? ? 124.51 118.30 6.21 0.90 N 8 1 CB A ASP 21 ? ? CG A ASP 21 ? ? OD2 A ASP 21 ? ? 111.53 118.30 -6.77 0.90 N 9 1 CA A TYR 25 ? ? CB A TYR 25 ? ? CG A TYR 25 ? ? 127.32 113.40 13.92 1.90 N 10 1 CB A TYR 28 ? ? CG A TYR 28 ? ? CD2 A TYR 28 ? ? 115.20 121.00 -5.80 0.60 N 11 1 CG1 A VAL 38 ? ? CB A VAL 38 ? ? CG2 A VAL 38 ? ? 100.64 110.90 -10.26 1.60 N 12 1 CB A ASP 39 ? ? CG A ASP 39 ? ? OD1 A ASP 39 ? ? 124.38 118.30 6.08 0.90 N 13 1 CB A ASP 39 ? ? CG A ASP 39 ? ? OD2 A ASP 39 ? ? 111.47 118.30 -6.83 0.90 N 14 1 CB A ASP 42 ? ? CG A ASP 42 ? ? OD1 A ASP 42 ? ? 111.57 118.30 -6.73 0.90 N 15 1 CB A ASP 42 ? ? CG A ASP 42 ? ? OD2 A ASP 42 ? ? 124.03 118.30 5.73 0.90 N 16 1 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.05 120.30 3.75 0.50 N 17 1 ND1 A HIS 48 ? ? CE1 A HIS 48 ? ? NE2 A HIS 48 ? ? 120.23 111.50 8.73 1.30 N 18 1 CB A ASP 49 ? ? CG A ASP 49 ? ? OD1 A ASP 49 ? ? 124.21 118.30 5.91 0.90 N 19 1 CB A ASP 49 ? ? CG A ASP 49 ? ? OD2 A ASP 49 ? ? 112.06 118.30 -6.24 0.90 N 20 1 CB A TYR 52 ? ? CG A TYR 52 ? ? CD2 A TYR 52 ? ? 110.99 121.00 -10.01 0.60 N 21 1 CB A TYR 52 ? ? CG A TYR 52 ? ? CD1 A TYR 52 ? ? 129.62 121.00 8.62 0.60 N 22 1 NE A ARG 53 ? ? CZ A ARG 53 ? ? NH1 A ARG 53 ? ? 123.97 120.30 3.67 0.50 N 23 1 CB A ASP 54 ? ? CG A ASP 54 ? ? OD2 A ASP 54 ? ? 112.29 118.30 -6.01 0.90 N 24 1 CB A ASP 59 ? ? CG A ASP 59 ? ? OD2 A ASP 59 ? ? 112.28 118.30 -6.02 0.90 N 25 1 CB A ASP 66 ? ? CG A ASP 66 ? ? OD2 A ASP 66 ? ? 112.25 118.30 -6.05 0.90 N 26 1 CB A TYR 75 ? ? CG A TYR 75 ? ? CD1 A TYR 75 ? ? 117.13 121.00 -3.87 0.60 N 27 1 CB A CYS 77 ? ? CA A CYS 77 ? ? C A CYS 77 ? ? 120.45 111.50 8.95 1.20 N 28 1 O A CYS 77 ? ? C A CYS 77 ? ? N A SER 78 ? ? 112.90 122.70 -9.80 1.60 Y 29 1 CA A THR 83 ? ? CB A THR 83 ? ? CG2 A THR 83 ? ? 121.44 112.40 9.04 1.40 N 30 1 N A SER 86 ? ? CA A SER 86 ? ? CB A SER 86 ? ? 101.08 110.50 -9.42 1.50 N 31 1 N A ASN 88 ? ? CA A ASN 88 ? ? CB A ASN 88 ? ? 99.09 110.60 -11.51 1.80 N 32 1 CB A ASP 99 ? ? CG A ASP 99 ? ? OD2 A ASP 99 ? ? 112.55 118.30 -5.75 0.90 N 33 1 NE A ARG 100 ? ? CZ A ARG 100 ? ? NH1 A ARG 100 ? ? 124.03 120.30 3.73 0.50 N 34 1 CB A HIS 115 ? ? CG A HIS 115 ? ? CD2 A HIS 115 ? ? 118.75 129.70 -10.95 1.60 N 35 1 ND1 A HIS 115 ? ? CE1 A HIS 115 ? ? NE2 A HIS 115 ? ? 122.23 111.50 10.73 1.30 N 36 1 CB A LYS 116 ? ? CA A LYS 116 ? ? C A LYS 116 ? ? 122.92 110.40 12.52 2.00 N 37 1 CA A LEU 118 ? ? C A LEU 118 ? ? N A ASP 119 ? ? 103.35 117.20 -13.85 2.20 Y 38 1 N A ASP 119 ? ? CA A ASP 119 ? ? CB A ASP 119 ? ? 92.60 110.60 -18.00 1.80 N 39 1 CB A ASP 119 ? ? CG A ASP 119 ? ? OD1 A ASP 119 ? ? 123.74 118.30 5.44 0.90 N 40 1 CB A ASP 119 ? ? CG A ASP 119 ? ? OD2 A ASP 119 ? ? 112.08 118.30 -6.22 0.90 N 41 1 CB A TYR 123 ? ? CA A TYR 123 ? ? C A TYR 123 ? ? 124.40 110.40 14.00 2.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 2 ? ? -65.65 89.48 2 1 TRP A 3 ? ? -146.15 -36.01 3 1 CYS A 11 ? ? -28.22 -61.16 4 1 PRO A 14 ? ? -53.97 102.95 5 1 PRO A 18 ? ? -27.52 -176.48 6 1 LEU A 19 ? ? -8.40 -43.29 7 1 THR A 36 ? ? -124.10 -152.82 8 1 PRO A 37 ? ? -73.16 -130.36 9 1 VAL A 38 ? ? -160.59 -79.91 10 1 GLU A 40 ? ? -60.70 9.15 11 1 ASN A 67 ? ? -151.66 88.66 12 1 PRO A 68 ? ? -92.13 59.74 13 1 THR A 70 ? ? -156.09 -18.52 14 1 SER A 72 ? ? 158.25 -66.46 15 1 SER A 74 ? ? -134.77 -158.68 16 1 CYS A 77 ? ? -119.24 -158.96 17 1 SER A 78 ? ? -171.42 17.09 18 1 ASN A 79 ? ? -68.58 -91.70 19 1 GLU A 81 ? ? 17.50 50.31 20 1 THR A 83 ? ? -138.54 -97.79 21 1 LYS A 87 ? ? -37.67 -21.77 22 1 ASN A 88 ? ? -1.04 117.24 23 1 ASN A 89 ? ? -90.39 -137.89 24 1 ALA A 90 ? ? -94.31 -66.19 25 1 ALA A 102 ? ? -20.79 -69.41 26 1 PRO A 110 ? ? -33.90 115.72 27 1 GLU A 114 ? ? -153.07 -64.79 28 1 THR A 120 ? ? -49.69 76.80 29 1 LYS A 122 ? ? -135.70 -72.44 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLN A 4 ? ? PHE A 5 ? ? 149.05 2 1 GLY A 33 ? ? SER A 34 ? ? -146.40 3 1 SER A 34 ? ? GLY A 35 ? ? 143.57 4 1 GLY A 35 ? ? THR A 36 ? ? 138.96 5 1 VAL A 38 ? ? ASP A 39 ? ? 141.85 6 1 LEU A 41 ? ? ASP A 42 ? ? 136.97 7 1 ASN A 57 ? ? LEU A 58 ? ? -136.31 8 1 PHE A 63 ? ? LEU A 64 ? ? 114.86 9 1 GLU A 71 ? ? SER A 72 ? ? -146.48 10 1 CYS A 77 ? ? SER A 78 ? ? 31.78 11 1 ASN A 79 ? ? THR A 80 ? ? 102.43 12 1 ASN A 85 ? ? SER A 86 ? ? -140.18 13 1 SER A 86 ? ? LYS A 87 ? ? 140.98 14 1 ASN A 101 ? ? ALA A 102 ? ? 145.60 15 1 ALA A 109 ? ? PRO A 110 ? ? 140.10 16 1 LYS A 113 ? ? GLU A 114 ? ? -127.65 17 1 LYS A 116 ? ? ASN A 117 ? ? 144.31 18 1 ASN A 117 ? ? LEU A 118 ? ? -146.90 19 1 ASP A 119 ? ? THR A 120 ? ? -133.80 20 1 THR A 120 ? ? LYS A 121 ? ? 123.21 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 25 ? ? 0.146 'SIDE CHAIN' 2 1 TYR A 28 ? ? 0.142 'SIDE CHAIN' 3 1 TYR A 75 ? ? 0.181 'SIDE CHAIN' 4 1 PHE A 94 ? ? 0.080 'SIDE CHAIN' 5 1 HIS A 115 ? ? 0.089 'SIDE CHAIN' 6 1 TYR A 123 ? ? 0.108 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #