data_1PRM # _entry.id 1PRM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PRM pdb_00001prm 10.2210/pdb1prm/pdb WWPDB D_1000175806 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1PRL _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PRM _pdbx_database_status.recvd_initial_deposition_date 1994-10-10 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Feng, S.' 1 'Chen, J.K.' 2 'Yu, H.' 3 'Simon, J.A.' 4 'Schreiber, S.L.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.' Science 266 1241 1247 1994 SCIEAS US 0036-8075 0038 ? 7526465 ? 1 'Structural Basis for the Binding of Proline-Rich Peptides to SH3 Domains' 'Cell(Cambridge,Mass.)' 76 933 ? 1994 CELLB5 US 0092-8674 0998 ? ? ? 2 'Solution Structure of the SH3 Domain of Src and Identification of its Ligand-Binding Site' Science 258 1665 ? 1992 SCIEAS US 0036-8075 0038 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Feng, S.' 1 ? primary 'Chen, J.K.' 2 ? primary 'Yu, H.' 3 ? primary 'Simon, J.A.' 4 ? primary 'Schreiber, S.L.' 5 ? 1 'Yu, H.' 6 ? 1 'Chen, J.K.' 7 ? 1 'Feng, S.' 8 ? 1 'Dalgarno, D.C.' 9 ? 1 'Brauer, A.W.' 10 ? 1 'Schreiber, S.L.' 11 ? 2 'Yu, H.' 12 ? 2 'Rosen, M.K.' 13 ? 2 'Shin, T.B.' 14 ? 2 'Seidel-Dugan, C.' 15 ? 2 'Brugge, J.S.' 16 ? 2 'Schreiber, S.L.' 17 ? # _cell.entry_id 1PRM _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PRM _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'C-SRC TYROSINE KINASE SH3 DOMAIN' 7003.641 1 ? ? ? ? 2 polymer man 'PROLINE-RICH LIGAND PLR1 (AFAPPLPRR)' 1026.234 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS GALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS C ? 2 'polypeptide(L)' no no AFAPPLPRR AFAPPLPRR A ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 LEU n 1 4 ALA n 1 5 GLY n 1 6 GLY n 1 7 VAL n 1 8 THR n 1 9 THR n 1 10 PHE n 1 11 VAL n 1 12 ALA n 1 13 LEU n 1 14 TYR n 1 15 ASP n 1 16 TYR n 1 17 GLU n 1 18 SER n 1 19 ARG n 1 20 THR n 1 21 GLU n 1 22 THR n 1 23 ASP n 1 24 LEU n 1 25 SER n 1 26 PHE n 1 27 LYS n 1 28 LYS n 1 29 GLY n 1 30 GLU n 1 31 ARG n 1 32 LEU n 1 33 GLN n 1 34 ILE n 1 35 VAL n 1 36 ASN n 1 37 ASN n 1 38 THR n 1 39 GLU n 1 40 GLY n 1 41 ASP n 1 42 TRP n 1 43 TRP n 1 44 LEU n 1 45 ALA n 1 46 HIS n 1 47 SER n 1 48 LEU n 1 49 THR n 1 50 THR n 1 51 GLY n 1 52 GLN n 1 53 THR n 1 54 GLY n 1 55 TYR n 1 56 ILE n 1 57 PRO n 1 58 SER n 1 59 ASN n 1 60 TYR n 1 61 VAL n 1 62 ALA n 1 63 PRO n 1 64 SER n 2 1 ALA n 2 2 PHE n 2 3 ALA n 2 4 PRO n 2 5 PRO n 2 6 LEU n 2 7 PRO n 2 8 ARG n 2 9 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus Gallus _entity_src_gen.pdbx_gene_src_gene 'SYNTHETIC OLIGO' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PGEX-2T GENE: SYNTHETIC OLIGO' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code 1 UNP SRC_CHICK P00523 1 76 ? ? 2 PDB 1PRM 1PRM 2 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1PRM C 1 ? 64 ? P00523 76 ? 139 ? 1 64 2 2 1PRM A 1 ? 9 ? 1PRM 71 ? 79 ? 71 79 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1PRM _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1PRM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1PRM _struct.title 'TWO BINDING ORIENTATIONS FOR PEPTIDES TO SRC SH3 DOMAIN: DEVELOPMENT OF A GENERAL MODEL FOR SH3-LIGAND INTERACTIONS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PRM _struct_keywords.pdbx_keywords 'COMPLEX (SIGNAL TRANSDUCTION/PEPTIDE)' _struct_keywords.text 'COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE), COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE) complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 10 ? ALA A 12 ? PHE C 10 ALA C 12 A 2 VAL A 61 ? PRO A 63 ? VAL C 61 PRO C 63 B 1 LEU A 32 ? ILE A 34 ? LEU C 32 ILE C 34 B 2 TRP A 43 ? SER A 47 ? TRP C 43 SER C 47 B 3 THR A 53 ? ILE A 56 ? THR C 53 ILE C 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 11 ? O VAL C 11 N ALA A 62 ? N ALA C 62 B 1 2 O GLN A 33 ? O GLN C 33 N HIS A 46 ? N HIS C 46 B 2 3 O TRP A 43 ? O TRP C 43 N ILE A 56 ? N ILE C 56 # _database_PDB_matrix.entry_id 1PRM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PRM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? C . n A 1 2 ALA 2 2 ? ? ? C . n A 1 3 LEU 3 3 ? ? ? C . n A 1 4 ALA 4 4 ? ? ? C . n A 1 5 GLY 5 5 ? ? ? C . n A 1 6 GLY 6 6 ? ? ? C . n A 1 7 VAL 7 7 ? ? ? C . n A 1 8 THR 8 8 ? ? ? C . n A 1 9 THR 9 9 9 THR THR C . n A 1 10 PHE 10 10 10 PHE PHE C . n A 1 11 VAL 11 11 11 VAL VAL C . n A 1 12 ALA 12 12 12 ALA ALA C . n A 1 13 LEU 13 13 13 LEU LEU C . n A 1 14 TYR 14 14 14 TYR TYR C . n A 1 15 ASP 15 15 15 ASP ASP C . n A 1 16 TYR 16 16 16 TYR TYR C . n A 1 17 GLU 17 17 17 GLU GLU C . n A 1 18 SER 18 18 18 SER SER C . n A 1 19 ARG 19 19 19 ARG ARG C . n A 1 20 THR 20 20 20 THR THR C . n A 1 21 GLU 21 21 21 GLU GLU C . n A 1 22 THR 22 22 22 THR THR C . n A 1 23 ASP 23 23 23 ASP ASP C . n A 1 24 LEU 24 24 24 LEU LEU C . n A 1 25 SER 25 25 25 SER SER C . n A 1 26 PHE 26 26 26 PHE PHE C . n A 1 27 LYS 27 27 27 LYS LYS C . n A 1 28 LYS 28 28 28 LYS LYS C . n A 1 29 GLY 29 29 29 GLY GLY C . n A 1 30 GLU 30 30 30 GLU GLU C . n A 1 31 ARG 31 31 31 ARG ARG C . n A 1 32 LEU 32 32 32 LEU LEU C . n A 1 33 GLN 33 33 33 GLN GLN C . n A 1 34 ILE 34 34 34 ILE ILE C . n A 1 35 VAL 35 35 35 VAL VAL C . n A 1 36 ASN 36 36 36 ASN ASN C . n A 1 37 ASN 37 37 37 ASN ASN C . n A 1 38 THR 38 38 38 THR THR C . n A 1 39 GLU 39 39 39 GLU GLU C . n A 1 40 GLY 40 40 40 GLY GLY C . n A 1 41 ASP 41 41 41 ASP ASP C . n A 1 42 TRP 42 42 42 TRP TRP C . n A 1 43 TRP 43 43 43 TRP TRP C . n A 1 44 LEU 44 44 44 LEU LEU C . n A 1 45 ALA 45 45 45 ALA ALA C . n A 1 46 HIS 46 46 46 HIS HIS C . n A 1 47 SER 47 47 47 SER SER C . n A 1 48 LEU 48 48 48 LEU LEU C . n A 1 49 THR 49 49 49 THR THR C . n A 1 50 THR 50 50 50 THR THR C . n A 1 51 GLY 51 51 51 GLY GLY C . n A 1 52 GLN 52 52 52 GLN GLN C . n A 1 53 THR 53 53 53 THR THR C . n A 1 54 GLY 54 54 54 GLY GLY C . n A 1 55 TYR 55 55 55 TYR TYR C . n A 1 56 ILE 56 56 56 ILE ILE C . n A 1 57 PRO 57 57 57 PRO PRO C . n A 1 58 SER 58 58 58 SER SER C . n A 1 59 ASN 59 59 59 ASN ASN C . n A 1 60 TYR 60 60 60 TYR TYR C . n A 1 61 VAL 61 61 61 VAL VAL C . n A 1 62 ALA 62 62 62 ALA ALA C . n A 1 63 PRO 63 63 63 PRO PRO C . n A 1 64 SER 64 64 64 SER SER C . n B 2 1 ALA 1 71 71 ALA ALA A . n B 2 2 PHE 2 72 72 PHE PHE A . n B 2 3 ALA 3 73 73 ALA ALA A . n B 2 4 PRO 4 74 74 PRO PRO A . n B 2 5 PRO 5 75 75 PRO PRO A . n B 2 6 LEU 6 76 76 LEU LEU A . n B 2 7 PRO 7 77 77 PRO PRO A . n B 2 8 ARG 8 78 78 ARG ARG A . n B 2 9 ARG 9 79 79 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-02-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 C _pdbx_validate_rmsd_bond.auth_comp_id_1 HIS _pdbx_validate_rmsd_bond.auth_seq_id_1 46 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 ND1 _pdbx_validate_rmsd_bond.auth_asym_id_2 C _pdbx_validate_rmsd_bond.auth_comp_id_2 HIS _pdbx_validate_rmsd_bond.auth_seq_id_2 46 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.267 _pdbx_validate_rmsd_bond.bond_target_value 1.369 _pdbx_validate_rmsd_bond.bond_deviation -0.102 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.015 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG C TRP 42 ? ? CD1 C TRP 42 ? ? NE1 C TRP 42 ? ? 103.67 110.10 -6.43 1.00 N 2 1 CD1 C TRP 42 ? ? NE1 C TRP 42 ? ? CE2 C TRP 42 ? ? 115.10 109.00 6.10 0.90 N 3 1 NE1 C TRP 42 ? ? CE2 C TRP 42 ? ? CZ2 C TRP 42 ? ? 138.84 130.40 8.44 1.10 N 4 1 NE1 C TRP 42 ? ? CE2 C TRP 42 ? ? CD2 C TRP 42 ? ? 101.03 107.30 -6.27 1.00 N 5 1 CG C TRP 43 ? ? CD1 C TRP 43 ? ? NE1 C TRP 43 ? ? 103.63 110.10 -6.47 1.00 N 6 1 CD1 C TRP 43 ? ? NE1 C TRP 43 ? ? CE2 C TRP 43 ? ? 115.09 109.00 6.09 0.90 N 7 1 NE1 C TRP 43 ? ? CE2 C TRP 43 ? ? CZ2 C TRP 43 ? ? 139.26 130.40 8.86 1.10 N 8 1 NE1 C TRP 43 ? ? CE2 C TRP 43 ? ? CD2 C TRP 43 ? ? 100.84 107.30 -6.46 1.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU C 17 ? ? -106.89 76.75 2 1 VAL C 35 ? ? -99.71 -82.87 3 1 ASN C 37 ? ? -163.69 101.94 4 1 THR C 38 ? ? -150.11 6.70 5 1 GLU C 39 ? ? -167.23 -75.08 6 1 THR C 49 ? ? -73.52 -70.81 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C GLY 1 ? A GLY 1 2 1 Y 1 C ALA 2 ? A ALA 2 3 1 Y 1 C LEU 3 ? A LEU 3 4 1 Y 1 C ALA 4 ? A ALA 4 5 1 Y 1 C GLY 5 ? A GLY 5 6 1 Y 1 C GLY 6 ? A GLY 6 7 1 Y 1 C VAL 7 ? A VAL 7 8 1 Y 1 C THR 8 ? A THR 8 #