data_1PRR # _entry.id 1PRR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PRR pdb_00001prr 10.2210/pdb1prr/pdb WWPDB D_1000175811 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1PRS _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PRR _pdbx_database_status.recvd_initial_deposition_date 1994-03-25 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bagby, S.' 1 'Harvey, T.S.' 2 'Eagle, S.G.' 3 'Inouye, S.' 4 'Ikura, M.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR-derived three-dimensional solution structure of protein S complexed with calcium.' Structure 2 107 122 1994 STRUE6 UK 0969-2126 2005 ? 8081742 '10.1016/S0969-2126(00)00013-7' 1 ;Structural Similarity of a Developmentally Regulated Bacterial Spore Coat Protein to Betagamma-Crystallins of the Vertebrate Eye Lens ; Proc.Natl.Acad.Sci.USA 91 4308 ? 1994 PNASA6 US 0027-8424 0040 ? ? ? 2 ;Unusual Helix-Containing Greek Keys in Development-Specific Ca2+-Binding Protein S. 1H, 15N and 13C Assignments and Secondary Structure Determined Using Multidimensional Double and Triple Resonance Heteronuclear NMR Spectroscopy ; Biochemistry 33 2409 ? 1994 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bagby, S.' 1 ? primary 'Harvey, T.S.' 2 ? primary 'Eagle, S.G.' 3 ? primary 'Inouye, S.' 4 ? primary 'Ikura, M.' 5 ? 1 'Bagby, S.' 6 ? 1 'Harvey, T.S.' 7 ? 1 'Eagle, S.G.' 8 ? 1 'Inouye, S.' 9 ? 1 'Ikura, M.' 10 ? 2 'Bagby, S.' 11 ? 2 'Harvey, T.S.' 12 ? 2 'Kay, L.E.' 13 ? 2 'Eagle, S.G.' 14 ? 2 'Inouye, S.' 15 ? 2 'Ikura, M.' 16 ? # _cell.entry_id 1PRR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PRR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DEVELOPMENT-SPECIFIC PROTEIN S' 18805.865 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MANITVFYNEDFQGKQVDLPPGNYTRAQLAALGIENNTISSVKVPPGVKAILYQNDGFAGDQIEVVANAEELGPLNNNVS SIRVISVPVQPRARFFYKEQFDGKEVDLPPGQYTQAELERYGIDNNTISSVKPQGLAVVLFKNDNFSGDTLPVNSDAPTL GAMNNNTSSIRIS ; _entity_poly.pdbx_seq_one_letter_code_can ;MANITVFYNEDFQGKQVDLPPGNYTRAQLAALGIENNTISSVKVPPGVKAILYQNDGFAGDQIEVVANAEELGPLNNNVS SIRVISVPVQPRARFFYKEQFDGKEVDLPPGQYTQAELERYGIDNNTISSVKPQGLAVVLFKNDNFSGDTLPVNSDAPTL GAMNNNTSSIRIS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASN n 1 4 ILE n 1 5 THR n 1 6 VAL n 1 7 PHE n 1 8 TYR n 1 9 ASN n 1 10 GLU n 1 11 ASP n 1 12 PHE n 1 13 GLN n 1 14 GLY n 1 15 LYS n 1 16 GLN n 1 17 VAL n 1 18 ASP n 1 19 LEU n 1 20 PRO n 1 21 PRO n 1 22 GLY n 1 23 ASN n 1 24 TYR n 1 25 THR n 1 26 ARG n 1 27 ALA n 1 28 GLN n 1 29 LEU n 1 30 ALA n 1 31 ALA n 1 32 LEU n 1 33 GLY n 1 34 ILE n 1 35 GLU n 1 36 ASN n 1 37 ASN n 1 38 THR n 1 39 ILE n 1 40 SER n 1 41 SER n 1 42 VAL n 1 43 LYS n 1 44 VAL n 1 45 PRO n 1 46 PRO n 1 47 GLY n 1 48 VAL n 1 49 LYS n 1 50 ALA n 1 51 ILE n 1 52 LEU n 1 53 TYR n 1 54 GLN n 1 55 ASN n 1 56 ASP n 1 57 GLY n 1 58 PHE n 1 59 ALA n 1 60 GLY n 1 61 ASP n 1 62 GLN n 1 63 ILE n 1 64 GLU n 1 65 VAL n 1 66 VAL n 1 67 ALA n 1 68 ASN n 1 69 ALA n 1 70 GLU n 1 71 GLU n 1 72 LEU n 1 73 GLY n 1 74 PRO n 1 75 LEU n 1 76 ASN n 1 77 ASN n 1 78 ASN n 1 79 VAL n 1 80 SER n 1 81 SER n 1 82 ILE n 1 83 ARG n 1 84 VAL n 1 85 ILE n 1 86 SER n 1 87 VAL n 1 88 PRO n 1 89 VAL n 1 90 GLN n 1 91 PRO n 1 92 ARG n 1 93 ALA n 1 94 ARG n 1 95 PHE n 1 96 PHE n 1 97 TYR n 1 98 LYS n 1 99 GLU n 1 100 GLN n 1 101 PHE n 1 102 ASP n 1 103 GLY n 1 104 LYS n 1 105 GLU n 1 106 VAL n 1 107 ASP n 1 108 LEU n 1 109 PRO n 1 110 PRO n 1 111 GLY n 1 112 GLN n 1 113 TYR n 1 114 THR n 1 115 GLN n 1 116 ALA n 1 117 GLU n 1 118 LEU n 1 119 GLU n 1 120 ARG n 1 121 TYR n 1 122 GLY n 1 123 ILE n 1 124 ASP n 1 125 ASN n 1 126 ASN n 1 127 THR n 1 128 ILE n 1 129 SER n 1 130 SER n 1 131 VAL n 1 132 LYS n 1 133 PRO n 1 134 GLN n 1 135 GLY n 1 136 LEU n 1 137 ALA n 1 138 VAL n 1 139 VAL n 1 140 LEU n 1 141 PHE n 1 142 LYS n 1 143 ASN n 1 144 ASP n 1 145 ASN n 1 146 PHE n 1 147 SER n 1 148 GLY n 1 149 ASP n 1 150 THR n 1 151 LEU n 1 152 PRO n 1 153 VAL n 1 154 ASN n 1 155 SER n 1 156 ASP n 1 157 ALA n 1 158 PRO n 1 159 THR n 1 160 LEU n 1 161 GLY n 1 162 ALA n 1 163 MET n 1 164 ASN n 1 165 ASN n 1 166 ASN n 1 167 THR n 1 168 SER n 1 169 SER n 1 170 ILE n 1 171 ARG n 1 172 ILE n 1 173 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Myxococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Myxococcus xanthus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DESS_MYXXA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02966 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MANITVFYNEDFQGKQVDLPPGNYTRAQLAALGIENNTISSVKVPPGVKAILYQNDGFAGDQIEVVANAEELGPLNNNVS SIRVISVPVQPRARFFYKEQFDGKEVDLPPGQYTQAELERYGIDNNTISSVKPQGLAVVLFKNDNFSGDTLPVNSDAPTL GAMNNNTSSIRIS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PRR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 173 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02966 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 173 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 173 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1PRR _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1PRR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1PRR _struct.title 'NMR-DERIVED THREE-DIMENSIONAL SOLUTION STRUCTURE OF PROTEIN S COMPLEXED WITH CALCIUM' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PRR _struct_keywords.pdbx_keywords 'BINDING PROTEIN' _struct_keywords.text 'BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ARG A 26 ? GLY A 33 ? ARG A 26 GLY A 33 1 ? 8 HELX_P HELX_P2 H2 GLN A 115 ? GLY A 122 ? GLN A 115 GLY A 122 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 10 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 10 A CA 174 1_555 ? ? ? ? ? ? ? 3.134 ? ? metalc2 metalc ? ? A GLU 10 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 10 A CA 174 1_555 ? ? ? ? ? ? ? 1.755 ? ? metalc3 metalc ? ? A GLU 71 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 71 A CA 174 1_555 ? ? ? ? ? ? ? 3.317 ? ? metalc4 metalc ? ? A GLU 99 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 99 A CA 175 1_555 ? ? ? ? ? ? ? 2.114 ? ? metalc5 metalc ? ? A THR 159 OG1 ? ? ? 1_555 C CA . CA ? ? A THR 159 A CA 175 1_555 ? ? ? ? ? ? ? 2.878 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details BN1 ? 4 ? BN2 ? 4 ? BC1 ? 4 ? BC2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense BN1 1 2 ? anti-parallel BN1 2 3 ? anti-parallel BN1 3 4 ? anti-parallel BN2 1 2 ? anti-parallel BN2 2 3 ? anti-parallel BN2 3 4 ? anti-parallel BC1 1 2 ? anti-parallel BC1 2 3 ? anti-parallel BC1 3 4 ? anti-parallel BC2 1 2 ? anti-parallel BC2 2 3 ? anti-parallel BC2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id BN1 1 LYS A 15 ? PRO A 20 ? LYS A 15 PRO A 20 BN1 2 ASN A 3 ? TYR A 8 ? ASN A 3 TYR A 8 BN1 3 SER A 41 ? VAL A 44 ? SER A 41 VAL A 44 BN1 4 ASN A 68 ? GLU A 70 ? ASN A 68 GLU A 70 BN2 1 GLY A 22 ? TYR A 24 ? GLY A 22 TYR A 24 BN2 2 SER A 81 ? SER A 86 ? SER A 81 SER A 86 BN2 3 VAL A 48 ? TYR A 53 ? VAL A 48 TYR A 53 BN2 4 ASP A 61 ? VAL A 65 ? ASP A 61 VAL A 65 BC1 1 LYS A 104 ? PRO A 109 ? LYS A 104 PRO A 109 BC1 2 ARG A 92 ? TYR A 97 ? ARG A 92 TYR A 97 BC1 3 SER A 130 ? PRO A 133 ? SER A 130 PRO A 133 BC1 4 ASP A 156 ? PRO A 158 ? ASP A 156 PRO A 158 BC2 1 GLY A 111 ? THR A 114 ? GLY A 111 THR A 114 BC2 2 SER A 169 ? SER A 173 ? SER A 169 SER A 173 BC2 3 ALA A 137 ? PHE A 141 ? ALA A 137 PHE A 141 BC2 4 ASP A 149 ? ASN A 154 ? ASP A 149 ASN A 154 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 174 ? 2 'BINDING SITE FOR RESIDUE CA A 174' AC2 Software A CA 175 ? 2 'BINDING SITE FOR RESIDUE CA A 175' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 GLU A 10 ? GLU A 10 . ? 1_555 ? 2 AC1 2 GLU A 71 ? GLU A 71 . ? 1_555 ? 3 AC2 2 GLU A 99 ? GLU A 99 . ? 1_555 ? 4 AC2 2 THR A 159 ? THR A 159 . ? 1_555 ? # _database_PDB_matrix.entry_id 1PRR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PRR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'SURFACE LOOPS AT RESIDUES 33 - 40, 72 - 80, 123 - 129, AND 159 - 168 ARE RELATIVELY POORLY DEFINED.' # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 SER 173 173 173 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 174 174 CA CA A . C 2 CA 1 175 175 CA CA A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 10 ? A GLU 10 ? 1_555 CA ? B CA . ? A CA 174 ? 1_555 OE2 ? A GLU 10 ? A GLU 10 ? 1_555 42.4 ? 2 OE1 ? A GLU 10 ? A GLU 10 ? 1_555 CA ? B CA . ? A CA 174 ? 1_555 OE2 ? A GLU 71 ? A GLU 71 ? 1_555 140.7 ? 3 OE2 ? A GLU 10 ? A GLU 10 ? 1_555 CA ? B CA . ? A CA 174 ? 1_555 OE2 ? A GLU 71 ? A GLU 71 ? 1_555 136.4 ? 4 OE2 ? A GLU 99 ? A GLU 99 ? 1_555 CA ? C CA . ? A CA 175 ? 1_555 OG1 ? A THR 159 ? A THR 159 ? 1_555 151.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-08-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH22 A ARG 83 ? ? H A VAL 84 ? ? 1.10 2 1 CE2 A PHE 7 ? ? NE2 A GLN 16 ? ? 2.18 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASN _pdbx_validate_rmsd_angle.auth_seq_id_1 166 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASN _pdbx_validate_rmsd_angle.auth_seq_id_2 166 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASN _pdbx_validate_rmsd_angle.auth_seq_id_3 166 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.62 _pdbx_validate_rmsd_angle.angle_target_value 113.40 _pdbx_validate_rmsd_angle.angle_deviation 16.22 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? 179.96 123.71 2 1 ASP A 11 ? ? 70.97 34.02 3 1 PHE A 12 ? ? 60.50 -2.33 4 1 LYS A 15 ? ? -33.29 143.09 5 1 PRO A 21 ? ? -58.65 -167.54 6 1 LEU A 32 ? ? -75.11 -73.29 7 1 ASN A 36 ? ? 62.87 -137.70 8 1 THR A 38 ? ? -154.69 -24.54 9 1 ILE A 39 ? ? -78.11 44.14 10 1 PRO A 46 ? ? -62.74 -178.38 11 1 GLN A 54 ? ? -45.99 -84.55 12 1 ASP A 56 ? ? -58.02 -177.16 13 1 VAL A 66 ? ? -141.12 -12.05 14 1 ALA A 67 ? ? -117.74 -156.66 15 1 GLU A 70 ? ? -73.80 -75.76 16 1 LEU A 72 ? ? 66.74 -81.88 17 1 ASN A 78 ? ? -170.32 122.43 18 1 SER A 80 ? ? -175.27 -40.96 19 1 PRO A 91 ? ? -59.36 -162.89 20 1 ARG A 92 ? ? -177.57 -161.64 21 1 TYR A 97 ? ? -101.54 -80.77 22 1 GLU A 99 ? ? -69.67 94.80 23 1 GLN A 100 ? ? 134.19 49.73 24 1 PHE A 101 ? ? 32.25 32.99 25 1 LYS A 104 ? ? -32.95 139.75 26 1 THR A 114 ? ? -93.04 -148.79 27 1 ALA A 116 ? ? -99.61 -62.47 28 1 LEU A 118 ? ? -34.49 -70.74 29 1 ARG A 120 ? ? -75.79 20.70 30 1 ILE A 123 ? ? -139.15 -106.57 31 1 ASP A 124 ? ? -172.36 -158.78 32 1 ASN A 125 ? ? -58.13 -81.02 33 1 THR A 127 ? ? 173.97 -0.87 34 1 ILE A 128 ? ? -67.95 -82.58 35 1 SER A 129 ? ? 76.35 -136.59 36 1 SER A 130 ? ? -38.54 128.98 37 1 LYS A 142 ? ? -63.03 -76.99 38 1 ASN A 143 ? ? -56.92 -178.92 39 1 ASP A 144 ? ? -64.47 -144.26 40 1 ASN A 145 ? ? -13.37 73.81 41 1 PHE A 146 ? ? 31.76 64.50 42 1 SER A 155 ? ? -170.39 -178.12 43 1 ALA A 157 ? ? -157.21 63.99 44 1 PRO A 158 ? ? -65.56 23.45 45 1 THR A 159 ? ? -170.00 96.57 46 1 LEU A 160 ? ? -123.79 -53.62 47 1 MET A 163 ? ? -142.08 -68.38 48 1 ASN A 164 ? ? -91.34 -108.45 49 1 ASN A 165 ? ? -153.63 -43.25 50 1 ASN A 166 ? ? -179.16 95.42 51 1 SER A 168 ? ? -95.84 -61.97 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 26 ? ? 0.225 'SIDE CHAIN' 2 1 ARG A 83 ? ? 0.315 'SIDE CHAIN' 3 1 ARG A 92 ? ? 0.216 'SIDE CHAIN' 4 1 ARG A 94 ? ? 0.280 'SIDE CHAIN' 5 1 ARG A 120 ? ? 0.265 'SIDE CHAIN' 6 1 ARG A 171 ? ? 0.087 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #