data_1PS2 # _entry.id 1PS2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PS2 pdb_00001ps2 10.2210/pdb1ps2/pdb WWPDB D_1000175818 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PS2 _pdbx_database_status.recvd_initial_deposition_date 1997-01-07 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Williams, M.A.' 1 'Polshakov, V.I.' 2 'Gargaro, A.R.' 3 'Feeney, J.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'High-resolution solution structure of human pNR-2/pS2: a single trefoil motif protein.' J.Mol.Biol. 267 418 432 1997 JMOBAK UK 0022-2836 0070 ? 9096235 10.1006/jmbi.1997.0896 1 ;Production and Comparison of Mature Single-Domain 'Trefoil' Peptides Pnr-2/Ps2 Cys58 and Pnr-2/Ps2 Ser58 ; Biochem.J. 308 1001 ? 1995 BIJOAK UK 0264-6021 0043 ? ? ? 2 ;NMR-Based Structural Studies of the Pnr-2/Ps2 Single Domain Trefoil Peptide. Similarities to Porcine Spasmolytic Peptide and Evidence for a Monomeric Structure ; Eur.J.Biochem. 233 847 ? 1995 EJBCAI IX 0014-2956 0262 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Polshakov, V.I.' 1 ? primary 'Williams, M.A.' 2 ? primary 'Gargaro, A.R.' 3 ? primary 'Frenkiel, T.A.' 4 ? primary 'Westley, B.R.' 5 ? primary 'Chadwick, M.P.' 6 ? primary 'May, F.E.' 7 ? primary 'Feeney, J.' 8 ? 1 'Chadwick, M.P.' 9 ? 1 'May, F.E.' 10 ? 1 'Westley, B.R.' 11 ? 2 'Polshakov, V.I.' 12 ? 2 'Frenkiel, T.A.' 13 ? 2 'Westley, B.' 14 ? 2 'Chadwick, M.' 15 ? 2 'May, F.' 16 ? 2 'Carr, M.D.' 17 ? 2 'Feeney, J.' 18 ? # _cell.entry_id 1PS2 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PS2 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description PS2 _entity.formula_weight 6662.300 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation C58S _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name PNR-2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEESEF _entity_poly.pdbx_seq_one_letter_code_can EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEESEF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ALA n 1 3 GLN n 1 4 THR n 1 5 GLU n 1 6 THR n 1 7 CYS n 1 8 THR n 1 9 VAL n 1 10 ALA n 1 11 PRO n 1 12 ARG n 1 13 GLU n 1 14 ARG n 1 15 GLN n 1 16 ASN n 1 17 CYS n 1 18 GLY n 1 19 PHE n 1 20 PRO n 1 21 GLY n 1 22 VAL n 1 23 THR n 1 24 PRO n 1 25 SER n 1 26 GLN n 1 27 CYS n 1 28 ALA n 1 29 ASN n 1 30 LYS n 1 31 GLY n 1 32 CYS n 1 33 CYS n 1 34 PHE n 1 35 ASP n 1 36 ASP n 1 37 THR n 1 38 VAL n 1 39 ARG n 1 40 GLY n 1 41 VAL n 1 42 PRO n 1 43 TRP n 1 44 CYS n 1 45 PHE n 1 46 TYR n 1 47 PRO n 1 48 ASN n 1 49 THR n 1 50 ILE n 1 51 ASP n 1 52 VAL n 1 53 PRO n 1 54 PRO n 1 55 GLU n 1 56 GLU n 1 57 GLU n 1 58 SER n 1 59 GLU n 1 60 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene BCEI _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue EPITHELIAL _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line HB101 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ 'BREAST, STOMACH' _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell 'MCF-7, UACL' _entity_src_gen.pdbx_gene_src_cellular_location EXTRACELLULAR _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene BCEI _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JM109 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line HB101 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector 'PHARMACIA PEZZ18' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TFF1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04155 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MATMENKVICALVLVSMLALGTLAEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEE ECEF ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PS2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04155 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 60 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1PS2 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 58 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P04155 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 82 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 58 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2-D H-1-H HOMONUCLEAR COSY' 1 2 1 TOCSY 1 3 1 'ROESY AND NOESY. 1-H/15-N HSQC-NOESY' 1 4 1 HNHA 1 5 1 HNHB 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 UNITY Varian 500 2 UNITYPLUS Varian 600 # _pdbx_nmr_refine.entry_id 1PS2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1PS2 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 19 _pdbx_nmr_ensemble.conformer_selection_criteria 'TOTAL NOE CONSTRAINT VIOLATIONS < 1.0 A' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR ? BRUNGER 1 'structure solution' X-PLOR 3.1 ? 2 # _exptl.entry_id 1PS2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1PS2 _struct.title 'HIGH RESOLUTION NMR SOLUTION STRUCTURE OF HUMAN PS2, 19 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PS2 _struct_keywords.pdbx_keywords 'GROWTH FACTOR' _struct_keywords.text 'GROWTH FACTOR, CELL MOTILITY, TUMOR SUPPRESSOR, TREFOIL DOMAIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 24 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 30 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 24 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 30 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 7 A CYS 33 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf2 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 17 A CYS 32 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 27 A CYS 44 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 33 ? PHE A 34 ? CYS A 33 PHE A 34 A 2 CYS A 44 ? PHE A 45 ? CYS A 44 PHE A 45 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 33 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 33 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 45 # _database_PDB_matrix.entry_id 1PS2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PS2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 PHE 60 60 60 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-07-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 13 ? ? -84.33 38.38 2 1 VAL A 22 ? ? -60.17 -178.97 3 1 PRO A 24 ? ? -36.05 -36.45 4 1 ASP A 36 ? ? -115.34 70.42 5 2 ALA A 2 ? ? -158.79 33.69 6 2 VAL A 22 ? ? -60.25 -176.31 7 2 ASP A 51 ? ? -107.29 -166.66 8 3 GLU A 13 ? ? -92.29 43.03 9 3 VAL A 22 ? ? -60.62 -171.21 10 3 PRO A 24 ? ? -34.91 -36.37 11 3 ASP A 36 ? ? -116.32 77.27 12 4 ALA A 2 ? ? -155.65 37.59 13 4 PRO A 11 ? ? -37.62 -33.92 14 4 GLU A 13 ? ? -82.73 40.97 15 4 PRO A 24 ? ? -36.33 -37.35 16 4 ASP A 36 ? ? -107.09 48.55 17 5 ALA A 2 ? ? -160.20 84.75 18 5 CYS A 7 ? ? -104.02 45.33 19 5 PRO A 11 ? ? -38.23 -28.79 20 5 GLU A 13 ? ? -90.56 44.40 21 5 PRO A 24 ? ? -34.88 -36.12 22 5 ASP A 36 ? ? -113.76 76.12 23 6 ALA A 2 ? ? -166.59 70.61 24 6 THR A 4 ? ? -171.77 -165.75 25 6 PRO A 11 ? ? -39.75 -31.32 26 6 GLU A 13 ? ? -103.58 50.82 27 6 VAL A 22 ? ? -60.54 -171.94 28 6 PRO A 24 ? ? -34.71 -31.93 29 6 ASP A 36 ? ? -110.91 64.55 30 6 ASN A 48 ? ? -168.79 79.22 31 6 PRO A 54 ? ? -33.63 128.05 32 7 CYS A 7 ? ? -97.31 45.84 33 7 PRO A 11 ? ? -36.87 -38.75 34 7 GLU A 13 ? ? -86.24 42.68 35 7 VAL A 22 ? ? -61.06 -172.38 36 7 PRO A 24 ? ? -35.07 -39.75 37 7 ASP A 35 ? ? -157.63 89.25 38 7 ASP A 36 ? ? -103.05 78.68 39 7 VAL A 52 ? ? -114.12 79.69 40 7 PRO A 54 ? ? -37.47 154.60 41 8 GLU A 13 ? ? -81.88 40.52 42 8 PRO A 24 ? ? -34.49 -33.03 43 8 ASP A 36 ? ? -108.08 59.49 44 8 THR A 49 ? ? -65.90 92.89 45 8 PRO A 53 ? ? -38.85 162.27 46 8 PRO A 54 ? ? -90.68 -72.91 47 9 PRO A 11 ? ? -37.93 -38.84 48 9 GLU A 13 ? ? -102.53 50.03 49 9 PRO A 24 ? ? -34.58 -31.87 50 9 ASP A 36 ? ? -113.55 66.06 51 9 THR A 37 ? ? -97.62 -69.82 52 9 THR A 49 ? ? -66.80 96.61 53 9 PRO A 53 ? ? -35.65 154.03 54 10 ALA A 2 ? ? -166.25 39.26 55 10 ASN A 16 ? ? -59.22 105.80 56 10 VAL A 22 ? ? -59.71 -172.79 57 10 PRO A 24 ? ? -34.98 -33.31 58 10 ASP A 35 ? ? -162.21 116.19 59 10 ASP A 36 ? ? -105.71 63.17 60 11 PRO A 11 ? ? -35.87 -31.13 61 11 GLU A 13 ? ? -79.07 39.81 62 11 PRO A 24 ? ? -36.03 -34.03 63 11 PRO A 54 ? ? -33.76 131.14 64 12 ALA A 2 ? ? -144.41 48.62 65 12 PRO A 11 ? ? -36.00 -38.24 66 12 GLU A 13 ? ? -79.11 39.67 67 12 VAL A 22 ? ? -61.06 -171.80 68 12 PRO A 24 ? ? -35.15 -31.43 69 12 ASP A 36 ? ? -104.48 70.64 70 12 ASN A 48 ? ? -158.29 82.84 71 12 PRO A 53 ? ? -34.83 91.09 72 12 PRO A 54 ? ? -92.20 -67.66 73 13 VAL A 22 ? ? -60.73 -169.98 74 13 PRO A 24 ? ? -38.16 -36.23 75 13 ASP A 35 ? ? -160.45 98.96 76 13 ASP A 36 ? ? -107.44 76.28 77 13 VAL A 52 ? ? -108.67 79.77 78 14 ALA A 2 ? ? -120.72 -169.46 79 14 PRO A 11 ? ? -38.36 -28.22 80 14 GLU A 13 ? ? -92.43 44.88 81 14 PRO A 24 ? ? -35.95 -38.70 82 14 ASP A 36 ? ? -112.14 72.92 83 14 THR A 37 ? ? -104.08 -61.92 84 15 ALA A 2 ? ? -155.89 20.55 85 15 THR A 4 ? ? -161.52 -165.38 86 15 PRO A 24 ? ? -34.91 -32.04 87 15 ASP A 35 ? ? -162.12 110.43 88 15 ASP A 36 ? ? -110.63 70.77 89 15 VAL A 52 ? ? -150.22 79.58 90 16 ALA A 2 ? ? -108.78 77.07 91 16 GLU A 13 ? ? -82.61 40.36 92 16 PRO A 24 ? ? -35.80 -38.75 93 16 ASP A 36 ? ? -111.54 60.27 94 16 THR A 49 ? ? -61.94 98.30 95 16 PRO A 54 ? ? -37.31 157.31 96 17 PRO A 11 ? ? -35.39 -36.41 97 17 ASP A 35 ? ? -165.29 118.70 98 17 PRO A 53 ? ? -49.66 -178.43 99 17 PRO A 54 ? ? -87.42 42.88 100 18 VAL A 22 ? ? -60.66 -174.74 101 18 PRO A 24 ? ? -35.85 -36.97 102 18 ASP A 36 ? ? -112.00 54.82 103 18 PRO A 53 ? ? -34.38 91.07 104 18 PRO A 54 ? ? -91.63 -159.34 105 19 GLU A 13 ? ? -85.29 36.62 106 19 PRO A 24 ? ? -35.74 -33.82 107 19 ASP A 36 ? ? -104.90 73.93 #