data_1PUX # _entry.id 1PUX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PUX pdb_00001pux 10.2210/pdb1pux/pdb RCSB RCSB019588 ? ? WWPDB D_1000019588 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-08-19 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PUX _pdbx_database_status.recvd_initial_deposition_date 2003-06-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1FSP 'Inactive Spo0F, 20 conformers' unspecified PDB 2FSP 'Inactive Spo0F, minimized mean' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gardino, A.K.' 1 'Volkman, B.F.' 2 'Cho, H.S.' 3 'Lee, S.Y.' 4 'Wemmer, D.E.' 5 'Kern, D.' 6 # _citation.id primary _citation.title 'The NMR solution structure of BeF(3)(-)-activated Spo0F reveals the conformational switch in a phosphorelay system.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 331 _citation.page_first 245 _citation.page_last 254 _citation.year 2003 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12875849 _citation.pdbx_database_id_DOI '10.1016/S0022-2836(03)00733-2' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gardino, A.K.' 1 ? primary 'Volkman, B.F.' 2 ? primary 'Cho, H.S.' 3 ? primary 'Lee, S.Y.' 4 ? primary 'Wemmer, D.E.' 5 ? primary 'Kern, D.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sporulation initiation phosphotransferase F' _entity.formula_weight 14244.660 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.-.- _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Stage 0 sporulation protein F' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVII MTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN ; _entity_poly.pdbx_seq_one_letter_code_can ;MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVII MTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 MET n 1 3 ASN n 1 4 GLU n 1 5 LYS n 1 6 ILE n 1 7 LEU n 1 8 ILE n 1 9 VAL n 1 10 ASP n 1 11 ASP n 1 12 GLN n 1 13 TYR n 1 14 GLY n 1 15 ILE n 1 16 ARG n 1 17 ILE n 1 18 LEU n 1 19 LEU n 1 20 ASN n 1 21 GLU n 1 22 VAL n 1 23 PHE n 1 24 ASN n 1 25 LYS n 1 26 GLU n 1 27 GLY n 1 28 TYR n 1 29 GLN n 1 30 THR n 1 31 PHE n 1 32 GLN n 1 33 ALA n 1 34 ALA n 1 35 ASN n 1 36 GLY n 1 37 LEU n 1 38 GLN n 1 39 ALA n 1 40 LEU n 1 41 ASP n 1 42 ILE n 1 43 VAL n 1 44 THR n 1 45 LYS n 1 46 GLU n 1 47 ARG n 1 48 PRO n 1 49 ASP n 1 50 LEU n 1 51 VAL n 1 52 LEU n 1 53 LEU n 1 54 ASP n 1 55 MET n 1 56 LYS n 1 57 ILE n 1 58 PRO n 1 59 GLY n 1 60 MET n 1 61 ASP n 1 62 GLY n 1 63 ILE n 1 64 GLU n 1 65 ILE n 1 66 LEU n 1 67 LYS n 1 68 ARG n 1 69 MET n 1 70 LYS n 1 71 VAL n 1 72 ILE n 1 73 ASP n 1 74 GLU n 1 75 ASN n 1 76 ILE n 1 77 ARG n 1 78 VAL n 1 79 ILE n 1 80 ILE n 1 81 MET n 1 82 THR n 1 83 ALA n 1 84 TYR n 1 85 GLY n 1 86 GLU n 1 87 LEU n 1 88 ASP n 1 89 MET n 1 90 ILE n 1 91 GLN n 1 92 GLU n 1 93 SER n 1 94 LYS n 1 95 GLU n 1 96 LEU n 1 97 GLY n 1 98 ALA n 1 99 LEU n 1 100 THR n 1 101 HIS n 1 102 PHE n 1 103 ALA n 1 104 LYS n 1 105 PRO n 1 106 PHE n 1 107 ASP n 1 108 ILE n 1 109 ASP n 1 110 GLU n 1 111 ILE n 1 112 ARG n 1 113 ASP n 1 114 ALA n 1 115 VAL n 1 116 LYS n 1 117 LYS n 1 118 TYR n 1 119 LEU n 1 120 PRO n 1 121 LEU n 1 122 LYS n 1 123 SER n 1 124 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene SPO0F _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) with pACYC' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET21a (NOVAGEN)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ASN 124 124 124 ASN ASN A . n # _cell.entry_id 1PUX _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PUX _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1PUX _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1PUX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1PUX _struct.title 'NMR Solution Structure of BeF3-Activated Spo0F, 20 conformers' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PUX _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'sporulation, (beta/alpha)5 barrel, response regulator, phosphorelay, beryllofluoride, two-component systems, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SP0F_BACSU _struct_ref.pdbx_db_accession P06628 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVII MTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PUX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06628 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 124 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 15 ? GLU A 26 ? ILE A 15 GLU A 26 1 ? 12 HELX_P HELX_P2 2 GLY A 36 ? ARG A 47 ? GLY A 36 ARG A 47 1 ? 12 HELX_P HELX_P3 3 GLY A 62 ? ILE A 72 ? GLY A 62 ILE A 72 1 ? 11 HELX_P HELX_P4 4 LEU A 87 ? LEU A 96 ? LEU A 87 LEU A 96 1 ? 10 HELX_P HELX_P5 5 ILE A 108 ? TYR A 118 ? ILE A 108 TYR A 118 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 29 ? ALA A 33 ? GLN A 29 ALA A 33 A 2 LYS A 5 ? VAL A 9 ? LYS A 5 VAL A 9 A 3 LEU A 50 ? LEU A 53 ? LEU A 50 LEU A 53 A 4 ARG A 77 ? MET A 81 ? ARG A 77 MET A 81 A 5 THR A 100 ? PHE A 102 ? THR A 100 PHE A 102 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 31 ? O PHE A 31 N ILE A 8 ? N ILE A 8 A 2 3 N LEU A 7 ? N LEU A 7 O LEU A 50 ? O LEU A 50 A 3 4 N LEU A 53 ? N LEU A 53 O ILE A 79 ? O ILE A 79 A 4 5 O ILE A 80 ? O ILE A 80 N PHE A 102 ? N PHE A 102 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 49 ? ? HE A ARG 77 ? ? 1.46 2 1 O A ASN 20 ? ? H A ASN 24 ? ? 1.50 3 1 O A GLU 64 ? ? H A ARG 68 ? ? 1.55 4 1 O A VAL 115 ? ? H A LEU 119 ? ? 1.57 5 1 O A LEU 87 ? ? H A GLN 91 ? ? 1.58 6 2 O A ASN 20 ? ? H A ASN 24 ? ? 1.47 7 2 H A VAL 9 ? ? O A LEU 52 ? ? 1.51 8 2 O A ALA 114 ? ? H A TYR 118 ? ? 1.51 9 2 O A ILE 42 ? ? H A GLU 46 ? ? 1.57 10 2 O A ILE 17 ? ? H A GLU 21 ? ? 1.59 11 3 O A ASN 20 ? ? H A ASN 24 ? ? 1.47 12 3 O A VAL 115 ? ? H A LEU 119 ? ? 1.51 13 3 O A GLU 64 ? ? H A ARG 68 ? ? 1.57 14 3 O A LEU 87 ? ? H A GLN 91 ? ? 1.58 15 3 O A ILE 17 ? ? H A GLU 21 ? ? 1.58 16 4 O A ASN 20 ? ? H A ASN 24 ? ? 1.48 17 4 O A LEU 87 ? ? H A GLN 91 ? ? 1.49 18 4 O A ILE 42 ? ? H A GLU 46 ? ? 1.49 19 4 O A GLU 64 ? ? H A ARG 68 ? ? 1.55 20 4 O A ALA 39 ? ? H A VAL 43 ? ? 1.55 21 4 H A VAL 9 ? ? O A LEU 52 ? ? 1.57 22 4 O A ILE 65 ? ? H A MET 69 ? ? 1.58 23 5 H A ILE 8 ? ? O A PHE 31 ? ? 1.51 24 5 O A ASN 20 ? ? H A ASN 24 ? ? 1.53 25 5 O A VAL 115 ? ? H A LEU 119 ? ? 1.53 26 5 O A LEU 87 ? ? H A GLN 91 ? ? 1.53 27 5 O A GLU 64 ? ? H A ARG 68 ? ? 1.54 28 5 O A LYS 5 ? ? H A ASP 49 ? ? 1.55 29 5 O A ILE 42 ? ? H A GLU 46 ? ? 1.60 30 6 O A LEU 87 ? ? H A GLN 91 ? ? 1.47 31 6 O A ASN 20 ? ? H A ASN 24 ? ? 1.47 32 6 O A ASP 49 ? ? HE A ARG 77 ? ? 1.51 33 6 O A ILE 65 ? ? H A MET 69 ? ? 1.53 34 6 O A GLU 64 ? ? H A ARG 68 ? ? 1.56 35 6 O A LYS 5 ? ? H A ASP 49 ? ? 1.58 36 7 O A LEU 87 ? ? H A GLN 91 ? ? 1.49 37 7 O A ASN 20 ? ? H A ASN 24 ? ? 1.51 38 7 O A GLN 91 ? ? H A GLU 95 ? ? 1.54 39 8 O A ASN 20 ? ? H A ASN 24 ? ? 1.47 40 8 O A ALA 39 ? ? H A VAL 43 ? ? 1.51 41 8 H A LYS 5 ? ? OD2 A ASP 49 ? ? 1.51 42 8 O A ASP 49 ? ? HE A ARG 77 ? ? 1.52 43 8 O A LEU 87 ? ? H A GLN 91 ? ? 1.53 44 8 O A GLU 64 ? ? H A ARG 68 ? ? 1.54 45 8 O A ILE 42 ? ? H A GLU 46 ? ? 1.56 46 8 O A LYS 94 ? ? H A GLY 97 ? ? 1.58 47 9 O A ASN 20 ? ? H A ASN 24 ? ? 1.43 48 9 O A ILE 42 ? ? H A GLU 46 ? ? 1.51 49 9 O A LEU 87 ? ? H A GLN 91 ? ? 1.52 50 10 O A ASN 20 ? ? H A ASN 24 ? ? 1.47 51 10 O A LEU 87 ? ? H A GLN 91 ? ? 1.48 52 10 O A VAL 115 ? ? H A LEU 119 ? ? 1.53 53 10 O A ILE 42 ? ? H A GLU 46 ? ? 1.54 54 11 O A ASN 20 ? ? H A ASN 24 ? ? 1.49 55 11 H A VAL 9 ? ? O A LEU 52 ? ? 1.52 56 11 O A ALA 114 ? ? H A TYR 118 ? ? 1.56 57 12 O A ASN 20 ? ? H A ASN 24 ? ? 1.38 58 12 O A LEU 87 ? ? H A GLN 91 ? ? 1.50 59 12 O A PHE 23 ? ? H A GLU 26 ? ? 1.53 60 12 H A VAL 9 ? ? O A LEU 52 ? ? 1.56 61 12 O A ILE 42 ? ? H A GLU 46 ? ? 1.57 62 13 O A ASN 20 ? ? H A ASN 24 ? ? 1.40 63 13 O A LEU 87 ? ? H A GLN 91 ? ? 1.48 64 13 O A GLU 64 ? ? H A ARG 68 ? ? 1.59 65 13 O A VAL 115 ? ? H A LEU 119 ? ? 1.59 66 13 O A ILE 42 ? ? H A GLU 46 ? ? 1.59 67 14 O A VAL 115 ? ? H A LEU 119 ? ? 1.48 68 14 O A ASN 20 ? ? H A ASN 24 ? ? 1.49 69 14 O A LEU 87 ? ? H A GLN 91 ? ? 1.50 70 14 O A GLU 64 ? ? H A ARG 68 ? ? 1.53 71 15 O A ALA 114 ? ? H A TYR 118 ? ? 1.45 72 15 H A VAL 9 ? ? O A LEU 52 ? ? 1.47 73 15 O A ASN 20 ? ? H A ASN 24 ? ? 1.50 74 15 O A LEU 87 ? ? H A GLN 91 ? ? 1.52 75 15 O A GLU 64 ? ? H A ARG 68 ? ? 1.58 76 16 O A ASN 20 ? ? H A ASN 24 ? ? 1.43 77 16 O A LEU 87 ? ? H A GLN 91 ? ? 1.49 78 16 O A PHE 23 ? ? H A GLU 26 ? ? 1.52 79 17 O A LEU 87 ? ? H A GLN 91 ? ? 1.46 80 17 O A ASN 20 ? ? H A ASN 24 ? ? 1.51 81 17 O A GLU 64 ? ? H A ARG 68 ? ? 1.57 82 17 H A VAL 9 ? ? O A LEU 52 ? ? 1.57 83 18 H A VAL 9 ? ? O A LEU 52 ? ? 1.46 84 18 O A ASN 20 ? ? H A ASN 24 ? ? 1.49 85 18 O A VAL 115 ? ? H A LEU 119 ? ? 1.55 86 19 O A ASN 20 ? ? H A ASN 24 ? ? 1.40 87 19 O A PHE 23 ? ? H A GLU 26 ? ? 1.49 88 19 O A GLU 86 ? ? H A MET 89 ? ? 1.52 89 19 O A ASP 49 ? ? HE A ARG 77 ? ? 1.53 90 19 O A GLU 64 ? ? H A ARG 68 ? ? 1.57 91 19 O A ILE 42 ? ? H A GLU 46 ? ? 1.59 92 20 O A ASN 20 ? ? H A ASN 24 ? ? 1.49 93 20 O A VAL 115 ? ? H A LEU 119 ? ? 1.50 94 20 O A ILE 42 ? ? H A GLU 46 ? ? 1.54 95 20 O A ALA 83 ? ? H A GLY 85 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 2 ? ? -128.51 -167.84 2 1 GLU A 4 ? ? -179.28 140.70 3 1 ASP A 10 ? ? 49.64 178.72 4 1 TYR A 13 ? ? -153.47 28.55 5 1 ASN A 35 ? ? 164.89 -176.37 6 1 ARG A 47 ? ? 23.83 61.77 7 1 LYS A 56 ? ? -44.05 106.01 8 1 MET A 60 ? ? 73.80 90.74 9 1 ASP A 61 ? ? -49.09 170.70 10 1 THR A 82 ? ? -177.80 149.84 11 1 TYR A 84 ? ? -68.69 57.46 12 1 GLU A 86 ? ? -105.54 45.31 13 1 THR A 100 ? ? -172.98 -165.97 14 1 LYS A 104 ? ? -22.42 -61.14 15 2 MET A 2 ? ? -111.87 -165.47 16 2 ASN A 3 ? ? -169.27 101.81 17 2 GLU A 4 ? ? -179.23 141.19 18 2 ASP A 10 ? ? 48.34 -177.17 19 2 TYR A 13 ? ? -158.44 28.05 20 2 ASN A 35 ? ? 160.13 -176.90 21 2 ARG A 47 ? ? 24.93 60.38 22 2 MET A 60 ? ? 69.81 122.47 23 2 THR A 82 ? ? -171.16 143.57 24 2 GLU A 86 ? ? -98.68 47.43 25 2 THR A 100 ? ? -167.34 -164.21 26 2 LYS A 104 ? ? -29.95 -58.80 27 2 LYS A 122 ? ? -41.48 99.50 28 3 MET A 2 ? ? 175.79 -152.46 29 3 ASN A 3 ? ? 84.08 147.82 30 3 GLU A 4 ? ? 170.39 156.71 31 3 ASP A 10 ? ? 43.45 -168.05 32 3 TYR A 13 ? ? -158.69 27.86 33 3 ASN A 35 ? ? 159.94 -174.08 34 3 ARG A 47 ? ? 25.78 60.50 35 3 LYS A 56 ? ? -53.57 105.12 36 3 MET A 60 ? ? 49.40 95.53 37 3 ASP A 61 ? ? -49.20 173.97 38 3 THR A 82 ? ? -175.28 143.51 39 3 TYR A 84 ? ? -78.07 49.32 40 3 LYS A 104 ? ? -25.20 -59.61 41 4 GLU A 4 ? ? 166.92 156.71 42 4 ASP A 10 ? ? 42.12 -164.63 43 4 TYR A 13 ? ? -162.72 28.73 44 4 ASN A 35 ? ? 170.13 -175.89 45 4 ARG A 47 ? ? 25.90 60.20 46 4 LEU A 50 ? ? -168.46 118.63 47 4 MET A 60 ? ? 68.75 112.98 48 4 THR A 82 ? ? -178.26 148.46 49 4 TYR A 84 ? ? -83.11 39.32 50 4 GLU A 86 ? ? -103.81 53.15 51 4 LYS A 104 ? ? -23.56 -62.09 52 5 GLU A 4 ? ? 64.44 141.93 53 5 ASP A 10 ? ? 46.08 -172.91 54 5 TYR A 13 ? ? -152.19 27.14 55 5 ASN A 35 ? ? 157.73 -177.36 56 5 ARG A 47 ? ? 28.55 61.21 57 5 LYS A 56 ? ? -57.01 106.87 58 5 MET A 60 ? ? 58.74 96.08 59 5 ASP A 61 ? ? -51.37 175.92 60 5 THR A 82 ? ? 178.37 145.83 61 5 TYR A 84 ? ? -67.23 -150.36 62 5 GLU A 86 ? ? -87.61 42.11 63 5 LYS A 104 ? ? -23.80 -60.19 64 6 MET A 2 ? ? 66.13 98.73 65 6 ASN A 3 ? ? 177.71 -164.03 66 6 ASP A 10 ? ? 40.00 -161.54 67 6 ASP A 11 ? ? 59.49 12.70 68 6 TYR A 13 ? ? -165.70 30.88 69 6 ASN A 35 ? ? 174.46 176.28 70 6 ARG A 47 ? ? 23.59 64.60 71 6 MET A 60 ? ? 62.08 111.67 72 6 THR A 82 ? ? -174.14 147.52 73 6 TYR A 84 ? ? -77.78 49.43 74 6 GLU A 86 ? ? -101.09 51.19 75 6 LYS A 104 ? ? -23.65 -61.91 76 7 ASN A 3 ? ? 172.36 143.36 77 7 GLU A 4 ? ? -177.77 149.11 78 7 ASP A 10 ? ? 47.25 -176.87 79 7 TYR A 13 ? ? -155.63 26.74 80 7 ASN A 35 ? ? 175.15 -179.32 81 7 ARG A 47 ? ? 25.06 60.69 82 7 LEU A 50 ? ? -168.27 118.28 83 7 MET A 55 ? ? -58.11 -71.34 84 7 MET A 60 ? ? 163.57 119.49 85 7 THR A 82 ? ? -177.39 143.24 86 7 GLU A 86 ? ? -104.06 49.31 87 7 THR A 100 ? ? -173.72 -154.81 88 7 LYS A 104 ? ? -23.91 -60.25 89 8 ASP A 10 ? ? 48.42 -177.92 90 8 TYR A 13 ? ? -158.60 28.11 91 8 ASN A 35 ? ? -179.06 -167.45 92 8 ARG A 47 ? ? 24.74 61.59 93 8 ILE A 57 ? ? -172.35 135.95 94 8 MET A 60 ? ? 79.74 91.56 95 8 ASP A 61 ? ? -48.48 174.74 96 8 THR A 82 ? ? -174.25 144.14 97 8 TYR A 84 ? ? -80.60 47.43 98 8 THR A 100 ? ? -171.37 -166.74 99 8 LYS A 104 ? ? -20.78 -61.87 100 9 MET A 2 ? ? 178.68 157.50 101 9 GLU A 4 ? ? 67.14 144.31 102 9 ASP A 10 ? ? 47.13 -175.27 103 9 TYR A 13 ? ? -153.66 27.52 104 9 ASN A 35 ? ? 175.02 -178.81 105 9 ARG A 47 ? ? 23.55 60.72 106 9 LYS A 56 ? ? -50.71 108.00 107 9 MET A 60 ? ? 63.83 84.74 108 9 ASP A 61 ? ? -47.14 172.09 109 9 THR A 82 ? ? -174.51 143.98 110 9 THR A 100 ? ? -174.26 -159.59 111 10 GLU A 4 ? ? 60.50 143.59 112 10 ASP A 10 ? ? 43.46 -168.25 113 10 TYR A 13 ? ? -151.95 27.80 114 10 ASN A 35 ? ? 171.05 -179.76 115 10 ARG A 47 ? ? 24.62 60.60 116 10 LEU A 50 ? ? -166.85 117.48 117 10 MET A 60 ? ? 61.22 103.70 118 10 THR A 82 ? ? 175.47 144.32 119 10 TYR A 84 ? ? -80.57 46.15 120 10 LYS A 104 ? ? -27.41 -60.52 121 10 LEU A 119 ? ? 170.64 144.99 122 11 MET A 2 ? ? 54.25 168.63 123 11 ASN A 3 ? ? 169.90 137.71 124 11 ASP A 10 ? ? 45.78 -172.49 125 11 TYR A 13 ? ? -164.62 27.84 126 11 ASN A 35 ? ? 159.52 -174.95 127 11 ARG A 47 ? ? 23.87 62.71 128 11 MET A 55 ? ? -78.71 -75.70 129 11 LYS A 56 ? ? -43.25 108.67 130 11 MET A 60 ? ? 74.30 89.51 131 11 ASP A 61 ? ? -50.66 176.51 132 11 THR A 82 ? ? 179.62 153.58 133 11 TYR A 84 ? ? -84.35 41.56 134 11 GLU A 86 ? ? -105.53 52.34 135 12 GLU A 4 ? ? 61.06 140.78 136 12 ASP A 10 ? ? 41.91 -165.33 137 12 TYR A 13 ? ? -150.90 26.22 138 12 ASN A 35 ? ? 158.79 -176.08 139 12 ARG A 47 ? ? 27.36 59.61 140 12 MET A 60 ? ? 172.90 106.56 141 12 ASP A 61 ? ? -65.44 -177.94 142 12 THR A 82 ? ? -175.41 144.16 143 12 TYR A 84 ? ? -79.60 47.47 144 12 LYS A 104 ? ? -24.90 -59.77 145 13 MET A 2 ? ? -161.00 31.29 146 13 GLU A 4 ? ? -51.21 -179.98 147 13 ASP A 10 ? ? 50.74 176.64 148 13 TYR A 13 ? ? -151.92 28.68 149 13 ASN A 35 ? ? 164.44 -178.05 150 13 ARG A 47 ? ? 25.75 59.35 151 13 LYS A 56 ? ? -44.60 96.50 152 13 MET A 60 ? ? 171.91 92.34 153 13 ASP A 61 ? ? -47.53 170.67 154 13 THR A 82 ? ? 178.75 147.04 155 13 TYR A 84 ? ? -80.55 45.67 156 13 GLU A 86 ? ? -141.31 49.85 157 13 THR A 100 ? ? -171.36 -162.81 158 13 LYS A 122 ? ? -45.24 108.07 159 14 MET A 2 ? ? 38.27 93.11 160 14 ASP A 10 ? ? 43.18 -165.75 161 14 TYR A 13 ? ? -160.49 28.64 162 14 ASN A 35 ? ? 165.33 -174.85 163 14 ARG A 47 ? ? 24.20 60.91 164 14 MET A 60 ? ? 52.98 97.49 165 14 ASP A 61 ? ? -54.20 179.71 166 14 THR A 82 ? ? -173.44 143.26 167 14 THR A 100 ? ? -164.29 -166.82 168 14 LYS A 104 ? ? -28.65 -59.95 169 14 LEU A 119 ? ? 172.32 144.59 170 14 LYS A 122 ? ? -39.73 109.61 171 15 MET A 2 ? ? -67.51 -168.01 172 15 GLU A 4 ? ? 176.02 152.62 173 15 ASP A 10 ? ? 50.59 177.70 174 15 TYR A 13 ? ? -162.48 27.39 175 15 ASN A 35 ? ? 163.76 -174.68 176 15 ARG A 47 ? ? 23.82 61.11 177 15 MET A 55 ? ? -78.90 -92.03 178 15 LYS A 56 ? ? -34.97 135.11 179 15 ILE A 57 ? ? 176.45 137.93 180 15 MET A 60 ? ? 61.23 90.42 181 15 ASP A 61 ? ? -56.86 177.13 182 15 THR A 82 ? ? -176.47 147.88 183 15 TYR A 84 ? ? -81.90 42.78 184 16 MET A 2 ? ? 177.02 172.15 185 16 ASN A 3 ? ? 172.84 159.52 186 16 GLU A 4 ? ? 165.82 160.57 187 16 ASP A 10 ? ? 46.97 -174.66 188 16 TYR A 13 ? ? -142.72 27.79 189 16 ASN A 35 ? ? 169.24 -173.74 190 16 ARG A 47 ? ? 27.61 59.64 191 16 MET A 60 ? ? 72.86 97.76 192 16 ASP A 61 ? ? -44.36 167.73 193 16 TYR A 84 ? ? -75.38 -151.52 194 16 GLU A 86 ? ? -88.55 45.05 195 16 LYS A 104 ? ? -23.17 -60.56 196 17 MET A 2 ? ? -113.31 -154.97 197 17 ASP A 10 ? ? 45.01 -171.81 198 17 TYR A 13 ? ? -149.58 27.89 199 17 ASN A 35 ? ? 162.12 -175.12 200 17 ARG A 47 ? ? 24.54 61.03 201 17 MET A 55 ? ? -58.99 -81.05 202 17 LYS A 56 ? ? -36.94 106.33 203 17 MET A 60 ? ? 179.09 104.49 204 17 ASP A 61 ? ? -42.55 164.15 205 17 THR A 82 ? ? -173.67 148.55 206 17 TYR A 84 ? ? -66.42 -150.46 207 17 GLU A 86 ? ? -87.62 43.37 208 17 THR A 100 ? ? -175.33 -167.61 209 17 LYS A 104 ? ? -28.33 -60.29 210 18 GLU A 4 ? ? 60.46 136.25 211 18 ASP A 10 ? ? 52.55 175.36 212 18 TYR A 13 ? ? -158.47 29.57 213 18 ARG A 47 ? ? 24.87 60.12 214 18 MET A 55 ? ? -64.46 -71.23 215 18 MET A 60 ? ? 65.42 95.95 216 18 ASP A 61 ? ? -48.88 176.16 217 18 THR A 82 ? ? 176.95 142.86 218 18 GLU A 86 ? ? -107.83 48.43 219 18 THR A 100 ? ? -167.57 -156.28 220 18 LEU A 119 ? ? 171.69 146.37 221 18 LYS A 122 ? ? -43.83 98.50 222 19 ASN A 3 ? ? 179.74 -174.93 223 19 ASP A 10 ? ? 45.44 -172.16 224 19 ARG A 47 ? ? 24.66 63.75 225 19 LEU A 50 ? ? -167.89 116.49 226 19 LYS A 56 ? ? -52.23 104.59 227 19 MET A 60 ? ? 69.08 86.70 228 19 ASP A 61 ? ? -46.80 171.91 229 19 TYR A 84 ? ? -83.92 34.59 230 19 GLU A 86 ? ? -102.22 47.82 231 19 LYS A 104 ? ? -24.66 -59.80 232 19 LYS A 122 ? ? 37.63 83.05 233 20 MET A 2 ? ? -43.50 166.05 234 20 GLU A 4 ? ? 174.70 151.15 235 20 ASP A 10 ? ? 48.78 -176.74 236 20 TYR A 13 ? ? -155.20 28.51 237 20 ARG A 47 ? ? 32.09 59.08 238 20 MET A 55 ? ? -33.95 -37.47 239 20 ILE A 57 ? ? 161.69 141.39 240 20 MET A 60 ? ? 54.74 102.43 241 20 ASP A 61 ? ? -45.99 171.57 242 20 THR A 82 ? ? -172.57 138.70 243 20 TYR A 84 ? ? -67.40 56.79 244 20 LYS A 104 ? ? -26.06 -62.34 245 20 LEU A 119 ? ? 173.72 144.06 246 20 LYS A 122 ? ? -40.75 108.51 # _pdbx_nmr_ensemble.entry_id 1PUX _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1PUX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'Uniform labeling with 15N and 13C' _pdbx_nmr_sample_details.solvent_system '1 mM Spo0F, 20 mM HEPES, 50 mM MgCl2, 6 mM BeCl2, and 60 mM NaF, 10% D20' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.85 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM MgCl2, 6 mM BeCl2, 60 mM NaF' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_details.entry_id 1PUX _pdbx_nmr_details.text 'This structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1PUX _pdbx_nmr_refine.method 'Torsion angle dynamics and simulated annealing' _pdbx_nmr_refine.details ;Structure based on a total of 1,835 distance constraints (obtained from 4,221 NOE crosspeaks), including 602 intraresidual, 504 short-range, 310 medium-range, and 383 long-range constraints as well as 165 dihedral angle restraints for a total of 2,000 restraints. DYANA 1.5 anneal command (20000) steps was used to generate 60 conformers. 20 lowest target function structures were analyzed. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' 'Guntert, P' 1 DYANA 1.5 refinement 'Guntert, P' 2 XEASY 1.3.12 'data analysis' 'Bartels, C' 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 500 2 ? Bruker DMX 600 3 ? Bruker DMX 750 # _atom_sites.entry_id 1PUX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #