data_1PVV # _entry.id 1PVV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1PVV RCSB RCSB019615 WWPDB D_1000019615 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1a1s _pdbx_database_related.details 'Crystal structure of Pyrococcus furiosus Ornithine Carbamoyltransferase at 2.7 A' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PVV _pdbx_database_status.recvd_initial_deposition_date 2003-06-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Massant, J.' 1 'Wouters, J.' 2 'Glansdorff, N.' 3 # _citation.id primary _citation.title 'Refined structure of Pyrococcus furiosus ornithine carbamoyltransferase at 1.87 A.' _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 59 _citation.page_first 2140 _citation.page_last 2149 _citation.year 2003 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14646072 _citation.pdbx_database_id_DOI 10.1107/S0907444903019231 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Massant, J.' 1 primary 'Wouters, J.' 2 primary 'Glansdorff, N.' 3 # _cell.entry_id 1PVV _cell.length_a 184.777 _cell.length_b 184.777 _cell.length_c 184.777 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 48 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PVV _symmetry.space_group_name_H-M 'F 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 196 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ornithine carbamoyltransferase' 35229.387 1 2.1.3.3 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 191 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name OTCase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVVSLAGRDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLGGHALYLNA QDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVY VGDGNNVAHSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAE AEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGGIKF ; _entity_poly.pdbx_seq_one_letter_code_can ;MVVSLAGRDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLGGHALYLNA QDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVY VGDGNNVAHSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAE AEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGGIKF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 VAL n 1 4 SER n 1 5 LEU n 1 6 ALA n 1 7 GLY n 1 8 ARG n 1 9 ASP n 1 10 LEU n 1 11 LEU n 1 12 CYS n 1 13 LEU n 1 14 GLN n 1 15 ASP n 1 16 TYR n 1 17 THR n 1 18 ALA n 1 19 GLU n 1 20 GLU n 1 21 ILE n 1 22 TRP n 1 23 THR n 1 24 ILE n 1 25 LEU n 1 26 GLU n 1 27 THR n 1 28 ALA n 1 29 LYS n 1 30 MET n 1 31 PHE n 1 32 LYS n 1 33 ILE n 1 34 TRP n 1 35 GLN n 1 36 LYS n 1 37 ILE n 1 38 GLY n 1 39 LYS n 1 40 PRO n 1 41 HIS n 1 42 ARG n 1 43 LEU n 1 44 LEU n 1 45 GLU n 1 46 GLY n 1 47 LYS n 1 48 THR n 1 49 LEU n 1 50 ALA n 1 51 MET n 1 52 ILE n 1 53 PHE n 1 54 GLN n 1 55 LYS n 1 56 PRO n 1 57 SER n 1 58 THR n 1 59 ARG n 1 60 THR n 1 61 ARG n 1 62 VAL n 1 63 SER n 1 64 PHE n 1 65 GLU n 1 66 VAL n 1 67 ALA n 1 68 MET n 1 69 ALA n 1 70 HIS n 1 71 LEU n 1 72 GLY n 1 73 GLY n 1 74 HIS n 1 75 ALA n 1 76 LEU n 1 77 TYR n 1 78 LEU n 1 79 ASN n 1 80 ALA n 1 81 GLN n 1 82 ASP n 1 83 LEU n 1 84 GLN n 1 85 LEU n 1 86 ARG n 1 87 ARG n 1 88 GLY n 1 89 GLU n 1 90 THR n 1 91 ILE n 1 92 ALA n 1 93 ASP n 1 94 THR n 1 95 ALA n 1 96 ARG n 1 97 VAL n 1 98 LEU n 1 99 SER n 1 100 ARG n 1 101 TYR n 1 102 VAL n 1 103 ASP n 1 104 ALA n 1 105 ILE n 1 106 MET n 1 107 ALA n 1 108 ARG n 1 109 VAL n 1 110 TYR n 1 111 ASP n 1 112 HIS n 1 113 LYS n 1 114 ASP n 1 115 VAL n 1 116 GLU n 1 117 ASP n 1 118 LEU n 1 119 ALA n 1 120 LYS n 1 121 TYR n 1 122 ALA n 1 123 THR n 1 124 VAL n 1 125 PRO n 1 126 VAL n 1 127 ILE n 1 128 ASN n 1 129 GLY n 1 130 LEU n 1 131 SER n 1 132 ASP n 1 133 PHE n 1 134 SER n 1 135 HIS n 1 136 PRO n 1 137 CYS n 1 138 GLN n 1 139 ALA n 1 140 LEU n 1 141 ALA n 1 142 ASP n 1 143 TYR n 1 144 MET n 1 145 THR n 1 146 ILE n 1 147 TRP n 1 148 GLU n 1 149 LYS n 1 150 LYS n 1 151 GLY n 1 152 THR n 1 153 ILE n 1 154 LYS n 1 155 GLY n 1 156 VAL n 1 157 LYS n 1 158 VAL n 1 159 VAL n 1 160 TYR n 1 161 VAL n 1 162 GLY n 1 163 ASP n 1 164 GLY n 1 165 ASN n 1 166 ASN n 1 167 VAL n 1 168 ALA n 1 169 HIS n 1 170 SER n 1 171 LEU n 1 172 MET n 1 173 ILE n 1 174 ALA n 1 175 GLY n 1 176 THR n 1 177 LYS n 1 178 LEU n 1 179 GLY n 1 180 ALA n 1 181 ASP n 1 182 VAL n 1 183 VAL n 1 184 VAL n 1 185 ALA n 1 186 THR n 1 187 PRO n 1 188 GLU n 1 189 GLY n 1 190 TYR n 1 191 GLU n 1 192 PRO n 1 193 ASP n 1 194 GLU n 1 195 LYS n 1 196 VAL n 1 197 ILE n 1 198 LYS n 1 199 TRP n 1 200 ALA n 1 201 GLU n 1 202 GLN n 1 203 ASN n 1 204 ALA n 1 205 ALA n 1 206 GLU n 1 207 SER n 1 208 GLY n 1 209 GLY n 1 210 SER n 1 211 PHE n 1 212 GLU n 1 213 LEU n 1 214 LEU n 1 215 HIS n 1 216 ASP n 1 217 PRO n 1 218 VAL n 1 219 LYS n 1 220 ALA n 1 221 VAL n 1 222 LYS n 1 223 ASP n 1 224 ALA n 1 225 ASP n 1 226 VAL n 1 227 ILE n 1 228 TYR n 1 229 THR n 1 230 ASP n 1 231 VAL n 1 232 TRP n 1 233 ALA n 1 234 SER n 1 235 MET n 1 236 GLY n 1 237 GLN n 1 238 GLU n 1 239 ALA n 1 240 GLU n 1 241 ALA n 1 242 GLU n 1 243 GLU n 1 244 ARG n 1 245 ARG n 1 246 LYS n 1 247 ILE n 1 248 PHE n 1 249 ARG n 1 250 PRO n 1 251 PHE n 1 252 GLN n 1 253 VAL n 1 254 ASN n 1 255 LYS n 1 256 ASP n 1 257 LEU n 1 258 VAL n 1 259 LYS n 1 260 HIS n 1 261 ALA n 1 262 LYS n 1 263 PRO n 1 264 ASP n 1 265 TYR n 1 266 MET n 1 267 PHE n 1 268 MET n 1 269 HIS n 1 270 CYS n 1 271 LEU n 1 272 PRO n 1 273 ALA n 1 274 HIS n 1 275 ARG n 1 276 GLY n 1 277 GLU n 1 278 GLU n 1 279 VAL n 1 280 THR n 1 281 ASP n 1 282 ASP n 1 283 VAL n 1 284 ILE n 1 285 ASP n 1 286 SER n 1 287 PRO n 1 288 ASN n 1 289 SER n 1 290 VAL n 1 291 VAL n 1 292 TRP n 1 293 ASP n 1 294 GLN n 1 295 ALA n 1 296 GLU n 1 297 ASN n 1 298 ARG n 1 299 LEU n 1 300 HIS n 1 301 ALA n 1 302 GLN n 1 303 LYS n 1 304 ALA n 1 305 VAL n 1 306 LEU n 1 307 ALA n 1 308 LEU n 1 309 VAL n 1 310 MET n 1 311 GLY n 1 312 GLY n 1 313 ILE n 1 314 LYS n 1 315 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene 'ARGF OR PF0594' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ;baker's yeast ; _entity_src_gen.pdbx_host_org_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4932 _entity_src_gen.host_org_genus Saccharomyces _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OTC_PYRFU _struct_ref.pdbx_db_accession Q51742 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVVSLAGRDLLCLQDYTAEEIWTILETAKMFKIWQKIGKPHRLLEGKTLAMIFQKPSTRTRVSFEVAMAHLGGHALYLNA QDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAKYATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVY VGDGNNVAHSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIYTDVWASMGQEAE AEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPNSVVWDQAENRLHAQKAVLALVMGGIKF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PVV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 315 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q51742 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 315 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 314 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1PVV _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.23 _exptl_crystal.density_percent_sol 67.02 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_details 'sodium acetate, ammonium sulfate, glycerol, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2001-09-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98900 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM30A' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM30A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.98900 # _reflns.entry_id 1PVV _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 99.00 _reflns.d_resolution_high 1.87 _reflns.number_obs 42928 _reflns.number_all 42928 _reflns.percent_possible_obs 98.5 _reflns.pdbx_Rmerge_I_obs 0.033 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.87 _reflns_shell.d_res_low 1.91 _reflns_shell.percent_possible_all 86.5 _reflns_shell.Rmerge_I_obs 0.187 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1PVV _refine.ls_number_reflns_obs 42928 _refine.ls_number_reflns_all 42928 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 99.00 _refine.ls_d_res_high 1.87 _refine.ls_percent_reflns_obs 98.5 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all 0.215 _refine.ls_R_factor_R_work 0.213 _refine.ls_R_factor_R_free 0.269 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5 _refine.ls_number_reflns_R_free 2153 _refine.ls_number_parameters 10575 _refine.ls_number_restraints 10110 _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method 'FREE R' _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1A1S' _refine.pdbx_method_to_determine_struct 'AB INITIO' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH AND HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1PVV _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues 0 _refine_analyze.occupancy_sum_hydrogen 0.00 _refine_analyze.occupancy_sum_non_hydrogen 2648.48 _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2454 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 191 _refine_hist.number_atoms_total 2653 _refine_hist.d_res_high 1.87 _refine_hist.d_res_low 99.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.023 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes 0.0238 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.033 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.052 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.192 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt 0.084 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.000 ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_all _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_all . 1.87 1.91 . . 86.5 . . . . 4853 . . 'X-RAY DIFFRACTION' . . 1.91 1.96 . . 94.5 . . . . 5302 . . 'X-RAY DIFFRACTION' . . 1.96 2.01 . . 99.6 . . . . 5627 . . 'X-RAY DIFFRACTION' . . 2.01 2.07 . . 100.0 . . . . 5654 . . 'X-RAY DIFFRACTION' . # _pdbx_refine.entry_id 1PVV _pdbx_refine.R_factor_all_no_cutoff 0.215 _pdbx_refine.R_factor_obs_no_cutoff 0.213 _pdbx_refine.free_R_factor_no_cutoff 0.269 _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff 5 _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff 0.197 _pdbx_refine.R_factor_obs_4sig_cutoff 0.195 _pdbx_refine.free_R_factor_4sig_cutoff 0.249 _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff 5 _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff 34266 _pdbx_refine.number_reflns_obs_no_cutoff ? _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.free_R_error_no_cutoff ? # _struct.entry_id 1PVV _struct.title 'Refined Structure of Pyrococcus furiosus Ornithine Carbamoyltransferase at 1.87 A' _struct.pdbx_descriptor 'Ornithine carbamoyltransferase (E.C.2.1.3.3)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PVV _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'dodecamer, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a dodecamer generated from the monomer in the asymmetric unit' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 12 ? TYR A 16 ? CYS A 11 TYR A 15 5 ? 5 HELX_P HELX_P2 2 THR A 17 ? GLY A 38 ? THR A 16 GLY A 37 1 ? 22 HELX_P HELX_P3 3 THR A 58 ? LEU A 71 ? THR A 57 LEU A 70 1 ? 14 HELX_P HELX_P4 4 GLN A 81 ? LEU A 83 ? GLN A 80 LEU A 82 5 ? 3 HELX_P HELX_P5 5 THR A 90 ? SER A 99 ? THR A 89 SER A 98 1 ? 10 HELX_P HELX_P6 6 ASP A 111 ? ALA A 122 ? ASP A 110 ALA A 121 1 ? 12 HELX_P HELX_P7 7 HIS A 135 ? GLY A 151 ? HIS A 134 GLY A 150 1 ? 17 HELX_P HELX_P8 8 ASN A 165 ? LEU A 178 ? ASN A 164 LEU A 177 1 ? 14 HELX_P HELX_P9 9 ASP A 193 ? GLY A 208 ? ASP A 192 GLY A 207 1 ? 16 HELX_P HELX_P10 10 ASP A 216 ? VAL A 221 ? ASP A 215 VAL A 220 1 ? 6 HELX_P HELX_P11 11 GLU A 242 ? ARG A 249 ? GLU A 241 ARG A 248 1 ? 8 HELX_P HELX_P12 12 PRO A 250 ? GLN A 252 ? PRO A 249 GLN A 251 5 ? 3 HELX_P HELX_P13 13 ASN A 254 ? HIS A 260 ? ASN A 253 HIS A 259 1 ? 7 HELX_P HELX_P14 14 THR A 280 ? ASP A 285 ? THR A 279 ASP A 284 1 ? 6 HELX_P HELX_P15 15 VAL A 290 ? GLY A 312 ? VAL A 289 GLY A 311 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 271 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 270 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 272 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 271 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.61 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 74 ? ASN A 79 ? HIS A 73 ASN A 78 A 2 THR A 48 ? PHE A 53 ? THR A 47 PHE A 52 A 3 ALA A 104 ? ARG A 108 ? ALA A 103 ARG A 107 A 4 VAL A 126 ? LEU A 130 ? VAL A 125 LEU A 129 B 1 SER A 210 ? LEU A 214 ? SER A 209 LEU A 213 B 2 ASP A 181 ? ALA A 185 ? ASP A 180 ALA A 184 B 3 LYS A 157 ? VAL A 161 ? LYS A 156 VAL A 160 B 4 VAL A 226 ? THR A 229 ? VAL A 225 THR A 228 B 5 MET A 266 ? HIS A 269 ? MET A 265 HIS A 268 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 76 ? O LEU A 75 N MET A 51 ? N MET A 50 A 2 3 N ILE A 52 ? N ILE A 51 O MET A 106 ? O MET A 105 A 3 4 N ALA A 107 ? N ALA A 106 O GLY A 129 ? O GLY A 128 B 1 2 O SER A 210 ? O SER A 209 N VAL A 182 ? N VAL A 181 B 2 3 O ALA A 185 ? O ALA A 184 N TYR A 160 ? N TYR A 159 B 3 4 N VAL A 159 ? N VAL A 158 O VAL A 226 ? O VAL A 225 B 4 5 N ILE A 227 ? N ILE A 226 O MET A 268 ? O MET A 267 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 A 401' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 SER A 57 ? SER A 56 . ? 9_555 ? 2 AC1 8 THR A 58 ? THR A 57 . ? 9_555 ? 3 AC1 8 ARG A 59 ? ARG A 58 . ? 9_555 ? 4 AC1 8 THR A 60 ? THR A 59 . ? 9_555 ? 5 AC1 8 GLN A 84 ? GLN A 83 . ? 1_555 ? 6 AC1 8 HOH D . ? HOH A 1001 . ? 1_555 ? 7 AC1 8 HOH D . ? HOH A 1003 . ? 9_555 ? 8 AC1 8 HOH D . ? HOH A 1026 . ? 1_555 ? 9 AC2 4 HIS A 74 ? HIS A 73 . ? 5_555 ? 10 AC2 4 HIS A 74 ? HIS A 73 . ? 9_555 ? 11 AC2 4 HIS A 74 ? HIS A 73 . ? 1_555 ? 12 AC2 4 HOH D . ? HOH A 1037 . ? 1_555 ? # _database_PDB_matrix.entry_id 1PVV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 1PVV _atom_sites.fract_transf_matrix[1][1] 0.005412 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005412 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005412 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 VAL 3 2 2 VAL VAL A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 LEU 5 4 4 LEU LEU A . n A 1 6 ALA 6 5 5 ALA ALA A . n A 1 7 GLY 7 6 6 GLY GLY A . n A 1 8 ARG 8 7 7 ARG ARG A . n A 1 9 ASP 9 8 8 ASP ASP A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 CYS 12 11 11 CYS CYS A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 GLN 14 13 13 GLN GLN A . n A 1 15 ASP 15 14 14 ASP ASP A . n A 1 16 TYR 16 15 15 TYR TYR A . n A 1 17 THR 17 16 16 THR THR A . n A 1 18 ALA 18 17 17 ALA ALA A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 GLU 20 19 19 GLU GLU A . n A 1 21 ILE 21 20 20 ILE ILE A . n A 1 22 TRP 22 21 21 TRP TRP A . n A 1 23 THR 23 22 22 THR THR A . n A 1 24 ILE 24 23 23 ILE ILE A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 GLU 26 25 25 GLU GLU A . n A 1 27 THR 27 26 26 THR THR A . n A 1 28 ALA 28 27 27 ALA ALA A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 MET 30 29 29 MET MET A . n A 1 31 PHE 31 30 30 PHE PHE A . n A 1 32 LYS 32 31 31 LYS LYS A . n A 1 33 ILE 33 32 32 ILE ILE A . n A 1 34 TRP 34 33 33 TRP TRP A . n A 1 35 GLN 35 34 34 GLN GLN A . n A 1 36 LYS 36 35 35 LYS LYS A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 GLY 38 37 37 GLY GLY A . n A 1 39 LYS 39 38 38 LYS LYS A . n A 1 40 PRO 40 39 39 PRO PRO A . n A 1 41 HIS 41 40 40 HIS HIS A . n A 1 42 ARG 42 41 41 ARG ARG A . n A 1 43 LEU 43 42 42 LEU LEU A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 GLU 45 44 44 GLU GLU A . n A 1 46 GLY 46 45 45 GLY GLY A . n A 1 47 LYS 47 46 46 LYS LYS A . n A 1 48 THR 48 47 47 THR THR A . n A 1 49 LEU 49 48 48 LEU LEU A . n A 1 50 ALA 50 49 49 ALA ALA A . n A 1 51 MET 51 50 50 MET MET A . n A 1 52 ILE 52 51 51 ILE ILE A . n A 1 53 PHE 53 52 52 PHE PHE A . n A 1 54 GLN 54 53 53 GLN GLN A . n A 1 55 LYS 55 54 54 LYS LYS A . n A 1 56 PRO 56 55 55 PRO PRO A . n A 1 57 SER 57 56 56 SER SER A . n A 1 58 THR 58 57 57 THR THR A . n A 1 59 ARG 59 58 58 ARG ARG A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 ARG 61 60 60 ARG ARG A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 SER 63 62 62 SER SER A . n A 1 64 PHE 64 63 63 PHE PHE A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 VAL 66 65 65 VAL VAL A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 MET 68 67 67 MET MET A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 HIS 70 69 69 HIS HIS A . n A 1 71 LEU 71 70 70 LEU LEU A . n A 1 72 GLY 72 71 71 GLY GLY A . n A 1 73 GLY 73 72 72 GLY GLY A . n A 1 74 HIS 74 73 73 HIS HIS A . n A 1 75 ALA 75 74 74 ALA ALA A . n A 1 76 LEU 76 75 75 LEU LEU A . n A 1 77 TYR 77 76 76 TYR TYR A . n A 1 78 LEU 78 77 77 LEU LEU A . n A 1 79 ASN 79 78 78 ASN ASN A . n A 1 80 ALA 80 79 79 ALA ALA A . n A 1 81 GLN 81 80 80 GLN GLN A . n A 1 82 ASP 82 81 81 ASP ASP A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 GLN 84 83 83 GLN GLN A . n A 1 85 LEU 85 84 84 LEU LEU A . n A 1 86 ARG 86 85 85 ARG ARG A . n A 1 87 ARG 87 86 86 ARG ARG A . n A 1 88 GLY 88 87 87 GLY GLY A . n A 1 89 GLU 89 88 88 GLU GLU A . n A 1 90 THR 90 89 89 THR THR A . n A 1 91 ILE 91 90 90 ILE ILE A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 THR 94 93 93 THR THR A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 ARG 96 95 95 ARG ARG A . n A 1 97 VAL 97 96 96 VAL VAL A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 ARG 100 99 99 ARG ARG A . n A 1 101 TYR 101 100 100 TYR TYR A . n A 1 102 VAL 102 101 101 VAL VAL A . n A 1 103 ASP 103 102 102 ASP ASP A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 ILE 105 104 104 ILE ILE A . n A 1 106 MET 106 105 105 MET MET A . n A 1 107 ALA 107 106 106 ALA ALA A . n A 1 108 ARG 108 107 107 ARG ARG A . n A 1 109 VAL 109 108 108 VAL VAL A . n A 1 110 TYR 110 109 109 TYR TYR A . n A 1 111 ASP 111 110 110 ASP ASP A . n A 1 112 HIS 112 111 111 HIS HIS A . n A 1 113 LYS 113 112 112 LYS LYS A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 GLU 116 115 115 GLU GLU A . n A 1 117 ASP 117 116 116 ASP ASP A . n A 1 118 LEU 118 117 117 LEU LEU A . n A 1 119 ALA 119 118 118 ALA ALA A . n A 1 120 LYS 120 119 119 LYS LYS A . n A 1 121 TYR 121 120 120 TYR TYR A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 THR 123 122 122 THR THR A . n A 1 124 VAL 124 123 123 VAL VAL A . n A 1 125 PRO 125 124 124 PRO PRO A . n A 1 126 VAL 126 125 125 VAL VAL A . n A 1 127 ILE 127 126 126 ILE ILE A . n A 1 128 ASN 128 127 127 ASN ASN A . n A 1 129 GLY 129 128 128 GLY GLY A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 SER 131 130 130 SER SER A . n A 1 132 ASP 132 131 131 ASP ASP A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 SER 134 133 133 SER SER A . n A 1 135 HIS 135 134 134 HIS HIS A . n A 1 136 PRO 136 135 135 PRO PRO A . n A 1 137 CYS 137 136 136 CYS CYS A . n A 1 138 GLN 138 137 137 GLN GLN A . n A 1 139 ALA 139 138 138 ALA ALA A . n A 1 140 LEU 140 139 139 LEU LEU A . n A 1 141 ALA 141 140 140 ALA ALA A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 TYR 143 142 142 TYR TYR A . n A 1 144 MET 144 143 143 MET MET A . n A 1 145 THR 145 144 144 THR THR A . n A 1 146 ILE 146 145 145 ILE ILE A . n A 1 147 TRP 147 146 146 TRP TRP A . n A 1 148 GLU 148 147 147 GLU GLU A . n A 1 149 LYS 149 148 148 LYS LYS A . n A 1 150 LYS 150 149 149 LYS LYS A . n A 1 151 GLY 151 150 150 GLY GLY A . n A 1 152 THR 152 151 151 THR THR A . n A 1 153 ILE 153 152 152 ILE ILE A . n A 1 154 LYS 154 153 153 LYS LYS A . n A 1 155 GLY 155 154 154 GLY GLY A . n A 1 156 VAL 156 155 155 VAL VAL A . n A 1 157 LYS 157 156 156 LYS LYS A . n A 1 158 VAL 158 157 157 VAL VAL A . n A 1 159 VAL 159 158 158 VAL VAL A . n A 1 160 TYR 160 159 159 TYR TYR A . n A 1 161 VAL 161 160 160 VAL VAL A . n A 1 162 GLY 162 161 161 GLY GLY A . n A 1 163 ASP 163 162 162 ASP ASP A . n A 1 164 GLY 164 163 163 GLY GLY A . n A 1 165 ASN 165 164 164 ASN ASN A . n A 1 166 ASN 166 165 165 ASN ASN A . n A 1 167 VAL 167 166 166 VAL VAL A . n A 1 168 ALA 168 167 167 ALA ALA A . n A 1 169 HIS 169 168 168 HIS HIS A . n A 1 170 SER 170 169 169 SER SER A . n A 1 171 LEU 171 170 170 LEU LEU A . n A 1 172 MET 172 171 171 MET MET A . n A 1 173 ILE 173 172 172 ILE ILE A . n A 1 174 ALA 174 173 173 ALA ALA A . n A 1 175 GLY 175 174 174 GLY GLY A . n A 1 176 THR 176 175 175 THR THR A . n A 1 177 LYS 177 176 176 LYS LYS A . n A 1 178 LEU 178 177 177 LEU LEU A . n A 1 179 GLY 179 178 178 GLY GLY A . n A 1 180 ALA 180 179 179 ALA ALA A . n A 1 181 ASP 181 180 180 ASP ASP A . n A 1 182 VAL 182 181 181 VAL VAL A . n A 1 183 VAL 183 182 182 VAL VAL A . n A 1 184 VAL 184 183 183 VAL VAL A . n A 1 185 ALA 185 184 184 ALA ALA A . n A 1 186 THR 186 185 185 THR THR A . n A 1 187 PRO 187 186 186 PRO PRO A . n A 1 188 GLU 188 187 187 GLU GLU A . n A 1 189 GLY 189 188 188 GLY GLY A . n A 1 190 TYR 190 189 189 TYR TYR A . n A 1 191 GLU 191 190 190 GLU GLU A . n A 1 192 PRO 192 191 191 PRO PRO A . n A 1 193 ASP 193 192 192 ASP ASP A . n A 1 194 GLU 194 193 193 GLU GLU A . n A 1 195 LYS 195 194 194 LYS LYS A . n A 1 196 VAL 196 195 195 VAL VAL A . n A 1 197 ILE 197 196 196 ILE ILE A . n A 1 198 LYS 198 197 197 LYS LYS A . n A 1 199 TRP 199 198 198 TRP TRP A . n A 1 200 ALA 200 199 199 ALA ALA A . n A 1 201 GLU 201 200 200 GLU GLU A . n A 1 202 GLN 202 201 201 GLN GLN A . n A 1 203 ASN 203 202 202 ASN ASN A . n A 1 204 ALA 204 203 203 ALA ALA A . n A 1 205 ALA 205 204 204 ALA ALA A . n A 1 206 GLU 206 205 205 GLU GLU A . n A 1 207 SER 207 206 206 SER SER A . n A 1 208 GLY 208 207 207 GLY GLY A . n A 1 209 GLY 209 208 208 GLY GLY A . n A 1 210 SER 210 209 209 SER SER A . n A 1 211 PHE 211 210 210 PHE PHE A . n A 1 212 GLU 212 211 211 GLU GLU A . n A 1 213 LEU 213 212 212 LEU LEU A . n A 1 214 LEU 214 213 213 LEU LEU A . n A 1 215 HIS 215 214 214 HIS HIS A . n A 1 216 ASP 216 215 215 ASP ASP A . n A 1 217 PRO 217 216 216 PRO PRO A . n A 1 218 VAL 218 217 217 VAL VAL A . n A 1 219 LYS 219 218 218 LYS LYS A . n A 1 220 ALA 220 219 219 ALA ALA A . n A 1 221 VAL 221 220 220 VAL VAL A . n A 1 222 LYS 222 221 221 LYS LYS A . n A 1 223 ASP 223 222 222 ASP ASP A . n A 1 224 ALA 224 223 223 ALA ALA A . n A 1 225 ASP 225 224 224 ASP ASP A . n A 1 226 VAL 226 225 225 VAL VAL A . n A 1 227 ILE 227 226 226 ILE ILE A . n A 1 228 TYR 228 227 227 TYR TYR A . n A 1 229 THR 229 228 228 THR THR A . n A 1 230 ASP 230 229 229 ASP ASP A . n A 1 231 VAL 231 230 230 VAL VAL A . n A 1 232 TRP 232 231 231 TRP TRP A . n A 1 233 ALA 233 232 232 ALA ALA A . n A 1 234 SER 234 233 233 SER SER A . n A 1 235 MET 235 234 234 MET MET A . n A 1 236 GLY 236 235 235 GLY GLY A . n A 1 237 GLN 237 236 236 GLN GLN A . n A 1 238 GLU 238 237 237 GLU GLU A . n A 1 239 ALA 239 238 238 ALA ALA A . n A 1 240 GLU 240 239 239 GLU GLU A . n A 1 241 ALA 241 240 240 ALA ALA A . n A 1 242 GLU 242 241 241 GLU GLU A . n A 1 243 GLU 243 242 242 GLU GLU A . n A 1 244 ARG 244 243 243 ARG ARG A . n A 1 245 ARG 245 244 244 ARG ARG A . n A 1 246 LYS 246 245 245 LYS LYS A . n A 1 247 ILE 247 246 246 ILE ILE A . n A 1 248 PHE 248 247 247 PHE PHE A . n A 1 249 ARG 249 248 248 ARG ARG A . n A 1 250 PRO 250 249 249 PRO PRO A . n A 1 251 PHE 251 250 250 PHE PHE A . n A 1 252 GLN 252 251 251 GLN GLN A . n A 1 253 VAL 253 252 252 VAL VAL A . n A 1 254 ASN 254 253 253 ASN ASN A . n A 1 255 LYS 255 254 254 LYS LYS A . n A 1 256 ASP 256 255 255 ASP ASP A . n A 1 257 LEU 257 256 256 LEU LEU A . n A 1 258 VAL 258 257 257 VAL VAL A . n A 1 259 LYS 259 258 258 LYS LYS A . n A 1 260 HIS 260 259 259 HIS HIS A . n A 1 261 ALA 261 260 260 ALA ALA A . n A 1 262 LYS 262 261 261 LYS LYS A . n A 1 263 PRO 263 262 262 PRO PRO A . n A 1 264 ASP 264 263 263 ASP ASP A . n A 1 265 TYR 265 264 264 TYR TYR A . n A 1 266 MET 266 265 265 MET MET A . n A 1 267 PHE 267 266 266 PHE PHE A . n A 1 268 MET 268 267 267 MET MET A . n A 1 269 HIS 269 268 268 HIS HIS A . n A 1 270 CYS 270 269 269 CYS CYS A . n A 1 271 LEU 271 270 270 LEU LEU A . n A 1 272 PRO 272 271 271 PRO PRO A . n A 1 273 ALA 273 272 272 ALA ALA A . n A 1 274 HIS 274 273 273 HIS HIS A . n A 1 275 ARG 275 274 274 ARG ARG A . n A 1 276 GLY 276 275 275 GLY GLY A . n A 1 277 GLU 277 276 276 GLU GLU A . n A 1 278 GLU 278 277 277 GLU GLU A . n A 1 279 VAL 279 278 278 VAL VAL A . n A 1 280 THR 280 279 279 THR THR A . n A 1 281 ASP 281 280 280 ASP ASP A . n A 1 282 ASP 282 281 281 ASP ASP A . n A 1 283 VAL 283 282 282 VAL VAL A . n A 1 284 ILE 284 283 283 ILE ILE A . n A 1 285 ASP 285 284 284 ASP ASP A . n A 1 286 SER 286 285 285 SER SER A . n A 1 287 PRO 287 286 286 PRO PRO A . n A 1 288 ASN 288 287 287 ASN ASN A . n A 1 289 SER 289 288 288 SER SER A . n A 1 290 VAL 290 289 289 VAL VAL A . n A 1 291 VAL 291 290 290 VAL VAL A . n A 1 292 TRP 292 291 291 TRP TRP A . n A 1 293 ASP 293 292 292 ASP ASP A . n A 1 294 GLN 294 293 293 GLN GLN A . n A 1 295 ALA 295 294 294 ALA ALA A . n A 1 296 GLU 296 295 295 GLU GLU A . n A 1 297 ASN 297 296 296 ASN ASN A . n A 1 298 ARG 298 297 297 ARG ARG A . n A 1 299 LEU 299 298 298 LEU LEU A . n A 1 300 HIS 300 299 299 HIS HIS A . n A 1 301 ALA 301 300 300 ALA ALA A . n A 1 302 GLN 302 301 301 GLN GLN A . n A 1 303 LYS 303 302 302 LYS LYS A . n A 1 304 ALA 304 303 303 ALA ALA A . n A 1 305 VAL 305 304 304 VAL VAL A . n A 1 306 LEU 306 305 305 LEU LEU A . n A 1 307 ALA 307 306 306 ALA ALA A . n A 1 308 LEU 308 307 307 LEU LEU A . n A 1 309 VAL 309 308 308 VAL VAL A . n A 1 310 MET 310 309 309 MET MET A . n A 1 311 GLY 311 310 310 GLY GLY A . n A 1 312 GLY 312 311 311 GLY GLY A . n A 1 313 ILE 313 312 312 ILE ILE A . n A 1 314 LYS 314 313 313 LYS LYS A . n A 1 315 PHE 315 314 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 401 SO4 SO4 A . C 2 SO4 1 402 402 SO4 SO4 A . D 3 HOH 1 1001 1001 HOH HOH A . D 3 HOH 2 1002 1002 HOH HOH A . D 3 HOH 3 1003 1003 HOH HOH A . D 3 HOH 4 1004 1004 HOH HOH A . D 3 HOH 5 1005 1005 HOH HOH A . D 3 HOH 6 1006 1006 HOH HOH A . D 3 HOH 7 1007 1007 HOH HOH A . D 3 HOH 8 1008 1008 HOH HOH A . D 3 HOH 9 1009 1009 HOH HOH A . D 3 HOH 10 1010 1010 HOH HOH A . D 3 HOH 11 1011 1011 HOH HOH A . D 3 HOH 12 1012 1012 HOH HOH A . D 3 HOH 13 1013 1013 HOH HOH A . D 3 HOH 14 1014 1014 HOH HOH A . D 3 HOH 15 1015 1015 HOH HOH A . D 3 HOH 16 1016 1016 HOH HOH A . D 3 HOH 17 1017 1017 HOH HOH A . D 3 HOH 18 1018 1018 HOH HOH A . D 3 HOH 19 1019 1019 HOH HOH A . D 3 HOH 20 1020 1020 HOH HOH A . D 3 HOH 21 1021 1021 HOH HOH A . D 3 HOH 22 1022 1022 HOH HOH A . D 3 HOH 23 1023 1023 HOH HOH A . D 3 HOH 24 1024 1024 HOH HOH A . D 3 HOH 25 1025 1025 HOH HOH A . D 3 HOH 26 1026 1026 HOH HOH A . D 3 HOH 27 1027 1027 HOH HOH A . D 3 HOH 28 1028 1028 HOH HOH A . D 3 HOH 29 1029 1029 HOH HOH A . D 3 HOH 30 1030 1030 HOH HOH A . D 3 HOH 31 1031 1031 HOH HOH A . D 3 HOH 32 1032 1032 HOH HOH A . D 3 HOH 33 1033 1033 HOH HOH A . D 3 HOH 34 1034 1034 HOH HOH A . D 3 HOH 35 1035 1035 HOH HOH A . D 3 HOH 36 1036 1036 HOH HOH A . D 3 HOH 37 1037 1037 HOH HOH A . D 3 HOH 38 1038 1038 HOH HOH A . D 3 HOH 39 1039 1039 HOH HOH A . D 3 HOH 40 1040 1040 HOH HOH A . D 3 HOH 41 1041 1041 HOH HOH A . D 3 HOH 42 1042 1042 HOH HOH A . D 3 HOH 43 1043 1043 HOH HOH A . D 3 HOH 44 1044 1044 HOH HOH A . D 3 HOH 45 1045 1045 HOH HOH A . D 3 HOH 46 1046 1046 HOH HOH A . D 3 HOH 47 1047 1047 HOH HOH A . D 3 HOH 48 1048 1048 HOH HOH A . D 3 HOH 49 1049 1049 HOH HOH A . D 3 HOH 50 1050 1050 HOH HOH A . D 3 HOH 51 1051 1051 HOH HOH A . D 3 HOH 52 1052 1052 HOH HOH A . D 3 HOH 53 1053 1053 HOH HOH A . D 3 HOH 54 1054 1054 HOH HOH A . D 3 HOH 55 1055 1055 HOH HOH A . D 3 HOH 56 1056 1056 HOH HOH A . D 3 HOH 57 1057 1057 HOH HOH A . D 3 HOH 58 1058 1058 HOH HOH A . D 3 HOH 59 1059 1059 HOH HOH A . D 3 HOH 60 1060 1060 HOH HOH A . D 3 HOH 61 1061 1061 HOH HOH A . D 3 HOH 62 1062 1062 HOH HOH A . D 3 HOH 63 1063 1063 HOH HOH A . D 3 HOH 64 1064 1064 HOH HOH A . D 3 HOH 65 1065 1065 HOH HOH A . D 3 HOH 66 1066 1066 HOH HOH A . D 3 HOH 67 1067 1067 HOH HOH A . D 3 HOH 68 1068 1068 HOH HOH A . D 3 HOH 69 1069 1069 HOH HOH A . D 3 HOH 70 1070 1070 HOH HOH A . D 3 HOH 71 1071 1071 HOH HOH A . D 3 HOH 72 1072 1072 HOH HOH A . D 3 HOH 73 1073 1073 HOH HOH A . D 3 HOH 74 1074 1074 HOH HOH A . D 3 HOH 75 1075 1075 HOH HOH A . D 3 HOH 76 1076 1076 HOH HOH A . D 3 HOH 77 1077 1077 HOH HOH A . D 3 HOH 78 1078 1078 HOH HOH A . D 3 HOH 79 1079 1079 HOH HOH A . D 3 HOH 80 1080 1080 HOH HOH A . D 3 HOH 81 1081 1081 HOH HOH A . D 3 HOH 82 1082 1082 HOH HOH A . D 3 HOH 83 1083 1083 HOH HOH A . D 3 HOH 84 1084 1084 HOH HOH A . D 3 HOH 85 1085 1085 HOH HOH A . D 3 HOH 86 1086 1086 HOH HOH A . D 3 HOH 87 1087 1087 HOH HOH A . D 3 HOH 88 1088 1088 HOH HOH A . D 3 HOH 89 1089 1089 HOH HOH A . D 3 HOH 90 1090 1090 HOH HOH A . D 3 HOH 91 1091 1091 HOH HOH A . D 3 HOH 92 1092 1092 HOH HOH A . D 3 HOH 93 1093 1093 HOH HOH A . D 3 HOH 94 1094 1094 HOH HOH A . D 3 HOH 95 1095 1095 HOH HOH A . D 3 HOH 96 1096 1096 HOH HOH A . D 3 HOH 97 1097 1097 HOH HOH A . D 3 HOH 98 1098 1098 HOH HOH A . D 3 HOH 99 1099 1099 HOH HOH A . D 3 HOH 100 1100 1100 HOH HOH A . D 3 HOH 101 1101 1101 HOH HOH A . D 3 HOH 102 1102 1102 HOH HOH A . D 3 HOH 103 1103 1103 HOH HOH A . D 3 HOH 104 1104 1104 HOH HOH A . D 3 HOH 105 1105 1105 HOH HOH A . D 3 HOH 106 1106 1106 HOH HOH A . D 3 HOH 107 1107 1107 HOH HOH A . D 3 HOH 108 1108 1108 HOH HOH A . D 3 HOH 109 1109 1109 HOH HOH A . D 3 HOH 110 1110 1110 HOH HOH A . D 3 HOH 111 1111 1111 HOH HOH A . D 3 HOH 112 1112 1112 HOH HOH A . D 3 HOH 113 1113 1113 HOH HOH A . D 3 HOH 114 1114 1114 HOH HOH A . D 3 HOH 115 1115 1115 HOH HOH A . D 3 HOH 116 1116 1116 HOH HOH A . D 3 HOH 117 1117 1117 HOH HOH A . D 3 HOH 118 1118 1118 HOH HOH A . D 3 HOH 119 1119 1119 HOH HOH A . D 3 HOH 120 1120 1120 HOH HOH A . D 3 HOH 121 1121 1121 HOH HOH A . D 3 HOH 122 1122 1122 HOH HOH A . D 3 HOH 123 1123 1123 HOH HOH A . D 3 HOH 124 1124 1124 HOH HOH A . D 3 HOH 125 1125 1125 HOH HOH A . D 3 HOH 126 1126 1126 HOH HOH A . D 3 HOH 127 1127 1127 HOH HOH A . D 3 HOH 128 1128 1128 HOH HOH A . D 3 HOH 129 1129 1129 HOH HOH A . D 3 HOH 130 1130 1130 HOH HOH A . D 3 HOH 131 1131 1131 HOH HOH A . D 3 HOH 132 1132 1132 HOH HOH A . D 3 HOH 133 1133 1133 HOH HOH A . D 3 HOH 134 1134 1134 HOH HOH A . D 3 HOH 135 1135 1135 HOH HOH A . D 3 HOH 136 1136 1136 HOH HOH A . D 3 HOH 137 1137 1137 HOH HOH A . D 3 HOH 138 1138 1138 HOH HOH A . D 3 HOH 139 1139 1139 HOH HOH A . D 3 HOH 140 1140 1140 HOH HOH A . D 3 HOH 141 1141 1141 HOH HOH A . D 3 HOH 142 1142 1142 HOH HOH A . D 3 HOH 143 1143 1143 HOH HOH A . D 3 HOH 144 1144 1144 HOH HOH A . D 3 HOH 145 1145 1145 HOH HOH A . D 3 HOH 146 1146 1146 HOH HOH A . D 3 HOH 147 1147 1147 HOH HOH A . D 3 HOH 148 1148 1148 HOH HOH A . D 3 HOH 149 1149 1149 HOH HOH A . D 3 HOH 150 1150 1150 HOH HOH A . D 3 HOH 151 1151 1151 HOH HOH A . D 3 HOH 152 1152 1152 HOH HOH A . D 3 HOH 153 1153 1153 HOH HOH A . D 3 HOH 154 1154 1154 HOH HOH A . D 3 HOH 155 1155 1155 HOH HOH A . D 3 HOH 156 1156 1156 HOH HOH A . D 3 HOH 157 1157 1157 HOH HOH A . D 3 HOH 158 1158 1158 HOH HOH A . D 3 HOH 159 1159 1159 HOH HOH A . D 3 HOH 160 1160 1160 HOH HOH A . D 3 HOH 161 1161 1161 HOH HOH A . D 3 HOH 162 1162 1162 HOH HOH A . D 3 HOH 163 1163 1163 HOH HOH A . D 3 HOH 164 1164 1164 HOH HOH A . D 3 HOH 165 1165 1165 HOH HOH A . D 3 HOH 166 1166 1166 HOH HOH A . D 3 HOH 167 1167 1167 HOH HOH A . D 3 HOH 168 1168 1168 HOH HOH A . D 3 HOH 169 1169 1169 HOH HOH A . D 3 HOH 170 1170 1170 HOH HOH A . D 3 HOH 171 1171 1171 HOH HOH A . D 3 HOH 172 1172 1172 HOH HOH A . D 3 HOH 173 1173 1173 HOH HOH A . D 3 HOH 174 1174 1174 HOH HOH A . D 3 HOH 175 1175 1175 HOH HOH A . D 3 HOH 176 1176 1176 HOH HOH A . D 3 HOH 177 1177 1177 HOH HOH A . D 3 HOH 178 1178 1178 HOH HOH A . D 3 HOH 179 1179 1179 HOH HOH A . D 3 HOH 180 1180 1180 HOH HOH A . D 3 HOH 181 1181 1181 HOH HOH A . D 3 HOH 182 1182 1182 HOH HOH A . D 3 HOH 183 1183 1183 HOH HOH A . D 3 HOH 184 1184 1184 HOH HOH A . D 3 HOH 185 1185 1185 HOH HOH A . D 3 HOH 186 1186 1186 HOH HOH A . D 3 HOH 187 1187 1187 HOH HOH A . D 3 HOH 188 1188 1188 HOH HOH A . D 3 HOH 189 1189 1189 HOH HOH A . D 3 HOH 190 1190 1190 HOH HOH A . D 3 HOH 191 1191 1191 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 48180 ? 1 MORE -414 ? 1 'SSA (A^2)' 111080 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A SO4 402 ? C SO4 . 2 1 A SO4 402 ? C SO4 . 3 1 A HOH 1024 ? D HOH . 4 1 A HOH 1033 ? D HOH . 5 1 A HOH 1065 ? D HOH . 6 1 A HOH 1094 ? D HOH . 7 1 A HOH 1159 ? D HOH . 8 1 A HOH 1187 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-12-09 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHELX 'model building' . ? 1 SHELXL-97 refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 SHELX phasing . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A SER 233 ? ? OE1 A GLN 236 ? ? 0.67 2 1 C A SER 233 ? ? OE1 A GLN 236 ? ? 1.43 3 1 O A SER 233 ? ? CD A GLN 236 ? ? 1.66 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 S _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SO4 _pdbx_validate_symm_contact.auth_seq_id_1 402 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 SO4 _pdbx_validate_symm_contact.auth_seq_id_2 402 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 9_555 _pdbx_validate_symm_contact.dist 1.45 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CD A ARG 41 ? ? NE A ARG 41 ? ? CZ A ARG 41 ? ? 141.55 123.60 17.95 1.40 N 2 1 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH1 A ARG 41 ? ? 124.18 120.30 3.88 0.50 N 3 1 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 117.19 120.30 -3.11 0.50 N 4 1 NE A ARG 95 ? ? CZ A ARG 95 ? ? NH1 A ARG 95 ? ? 125.34 120.30 5.04 0.50 N 5 1 NE A ARG 99 ? ? CZ A ARG 99 ? ? NH1 A ARG 99 ? ? 125.38 120.30 5.08 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 40 ? ? -155.57 61.88 2 1 TYR A 109 ? ? -77.91 -73.15 3 1 LEU A 129 ? ? 159.18 131.25 4 1 ASN A 164 ? ? -109.03 -161.68 5 1 TYR A 189 ? ? -118.93 55.23 6 1 ALA A 232 ? ? -59.20 106.28 7 1 GLN A 236 ? ? -30.41 77.33 8 1 ALA A 238 ? ? -11.53 -95.59 9 1 ALA A 240 ? ? 157.62 10.65 10 1 GLU A 241 ? ? 173.63 23.81 11 1 LEU A 270 ? ? 65.02 160.23 12 1 GLU A 276 ? ? -105.15 -100.05 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A SO4 402 ? O3 ? C SO4 1 O3 2 1 N 1 A SO4 402 ? O4 ? C SO4 1 O4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A PHE 314 ? A PHE 315 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #