data_1Q1O # _entry.id 1Q1O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Q1O pdb_00001q1o 10.2210/pdb1q1o/pdb RCSB RCSB019804 ? ? WWPDB D_1000019804 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-10-14 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Q1O _pdbx_database_status.recvd_initial_deposition_date 2003-07-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1IP9 'The Same Domain Family and the Binding Partner' unspecified PDB 1IPG 'The Same Domain Family and the Binding Partner' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yoshinaga, S.' 1 'Kohjima, M.' 2 'Ogura, K.' 3 'Yokochi, M.' 4 'Takeya, R.' 5 'Ito, T.' 6 'Sumimoto, H.' 7 'Inagaki, F.' 8 # _citation.id primary _citation.title 'The PB1 domain and the PC motif-containing region are structurally similar protein binding modules' _citation.journal_abbrev 'EMBO J.' _citation.journal_volume 22 _citation.page_first 4888 _citation.page_last 4897 _citation.year 2003 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14517229 _citation.pdbx_database_id_DOI 10.1093/emboj/cdg475 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yoshinaga, S.' 1 ? primary 'Kohjima, M.' 2 ? primary 'Ogura, K.' 3 ? primary 'Yokochi, M.' 4 ? primary 'Takeya, R.' 5 ? primary 'Ito, T.' 6 ? primary 'Sumimoto, H.' 7 ? primary 'Inagaki, F.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cell division control protein 24' _entity.formula_weight 11211.426 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PB1 Domain (Long Form)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cdc24p, Calcium regulatory protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSILFRISYNNNSNNTSSSEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNV AKEMLAENNEKFLNIRLY ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSILFRISYNNNSNNTSSSEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNV AKEMLAENNEKFLNIRLY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 ILE n 1 7 LEU n 1 8 PHE n 1 9 ARG n 1 10 ILE n 1 11 SER n 1 12 TYR n 1 13 ASN n 1 14 ASN n 1 15 ASN n 1 16 SER n 1 17 ASN n 1 18 ASN n 1 19 THR n 1 20 SER n 1 21 SER n 1 22 SER n 1 23 GLU n 1 24 ILE n 1 25 PHE n 1 26 THR n 1 27 LEU n 1 28 LEU n 1 29 VAL n 1 30 GLU n 1 31 LYS n 1 32 VAL n 1 33 TRP n 1 34 ASN n 1 35 PHE n 1 36 ASP n 1 37 ASP n 1 38 LEU n 1 39 ILE n 1 40 MET n 1 41 ALA n 1 42 ILE n 1 43 ASN n 1 44 SER n 1 45 LYS n 1 46 ILE n 1 47 SER n 1 48 ASN n 1 49 THR n 1 50 HIS n 1 51 ASN n 1 52 ASN n 1 53 ASN n 1 54 ILE n 1 55 SER n 1 56 PRO n 1 57 ILE n 1 58 THR n 1 59 LYS n 1 60 ILE n 1 61 LYS n 1 62 TYR n 1 63 GLN n 1 64 ASP n 1 65 GLU n 1 66 ASP n 1 67 GLY n 1 68 ASP n 1 69 PHE n 1 70 VAL n 1 71 VAL n 1 72 LEU n 1 73 GLY n 1 74 SER n 1 75 ASP n 1 76 GLU n 1 77 ASP n 1 78 TRP n 1 79 ASN n 1 80 VAL n 1 81 ALA n 1 82 LYS n 1 83 GLU n 1 84 MET n 1 85 LEU n 1 86 ALA n 1 87 GLU n 1 88 ASN n 1 89 ASN n 1 90 GLU n 1 91 LYS n 1 92 PHE n 1 93 LEU n 1 94 ASN n 1 95 ILE n 1 96 ARG n 1 97 LEU n 1 98 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene Cdc24p _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX6p-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 757 757 GLY GLY A . n A 1 2 PRO 2 758 758 PRO PRO A . n A 1 3 LEU 3 759 759 LEU LEU A . n A 1 4 GLY 4 760 760 GLY GLY A . n A 1 5 SER 5 761 761 SER SER A . n A 1 6 ILE 6 762 762 ILE ILE A . n A 1 7 LEU 7 763 763 LEU LEU A . n A 1 8 PHE 8 764 764 PHE PHE A . n A 1 9 ARG 9 765 765 ARG ARG A . n A 1 10 ILE 10 766 766 ILE ILE A . n A 1 11 SER 11 767 767 SER SER A . n A 1 12 TYR 12 768 768 TYR TYR A . n A 1 13 ASN 13 769 769 ASN ASN A . n A 1 14 ASN 14 770 770 ASN ASN A . n A 1 15 ASN 15 771 771 ASN ASN A . n A 1 16 SER 16 772 772 SER SER A . n A 1 17 ASN 17 773 773 ASN ASN A . n A 1 18 ASN 18 774 774 ASN ASN A . n A 1 19 THR 19 775 775 THR THR A . n A 1 20 SER 20 776 776 SER SER A . n A 1 21 SER 21 777 777 SER SER A . n A 1 22 SER 22 778 778 SER SER A . n A 1 23 GLU 23 779 779 GLU GLU A . n A 1 24 ILE 24 780 780 ILE ILE A . n A 1 25 PHE 25 781 781 PHE PHE A . n A 1 26 THR 26 782 782 THR THR A . n A 1 27 LEU 27 783 783 LEU LEU A . n A 1 28 LEU 28 784 784 LEU LEU A . n A 1 29 VAL 29 785 785 VAL VAL A . n A 1 30 GLU 30 786 786 GLU GLU A . n A 1 31 LYS 31 787 787 LYS LYS A . n A 1 32 VAL 32 788 788 VAL VAL A . n A 1 33 TRP 33 789 789 TRP TRP A . n A 1 34 ASN 34 790 790 ASN ASN A . n A 1 35 PHE 35 791 791 PHE PHE A . n A 1 36 ASP 36 792 792 ASP ASP A . n A 1 37 ASP 37 793 793 ASP ASP A . n A 1 38 LEU 38 794 794 LEU LEU A . n A 1 39 ILE 39 795 795 ILE ILE A . n A 1 40 MET 40 796 796 MET MET A . n A 1 41 ALA 41 797 797 ALA ALA A . n A 1 42 ILE 42 798 798 ILE ILE A . n A 1 43 ASN 43 799 799 ASN ASN A . n A 1 44 SER 44 800 800 SER SER A . n A 1 45 LYS 45 801 801 LYS LYS A . n A 1 46 ILE 46 802 802 ILE ILE A . n A 1 47 SER 47 803 803 SER SER A . n A 1 48 ASN 48 804 804 ASN ASN A . n A 1 49 THR 49 805 805 THR THR A . n A 1 50 HIS 50 806 806 HIS HIS A . n A 1 51 ASN 51 807 807 ASN ASN A . n A 1 52 ASN 52 808 808 ASN ASN A . n A 1 53 ASN 53 809 809 ASN ASN A . n A 1 54 ILE 54 810 810 ILE ILE A . n A 1 55 SER 55 811 811 SER SER A . n A 1 56 PRO 56 812 812 PRO PRO A . n A 1 57 ILE 57 813 813 ILE ILE A . n A 1 58 THR 58 814 814 THR THR A . n A 1 59 LYS 59 815 815 LYS LYS A . n A 1 60 ILE 60 816 816 ILE ILE A . n A 1 61 LYS 61 817 817 LYS LYS A . n A 1 62 TYR 62 818 818 TYR TYR A . n A 1 63 GLN 63 819 819 GLN GLN A . n A 1 64 ASP 64 820 820 ASP ASP A . n A 1 65 GLU 65 821 821 GLU GLU A . n A 1 66 ASP 66 822 822 ASP ASP A . n A 1 67 GLY 67 823 823 GLY GLY A . n A 1 68 ASP 68 824 824 ASP ASP A . n A 1 69 PHE 69 825 825 PHE PHE A . n A 1 70 VAL 70 826 826 VAL VAL A . n A 1 71 VAL 71 827 827 VAL VAL A . n A 1 72 LEU 72 828 828 LEU LEU A . n A 1 73 GLY 73 829 829 GLY GLY A . n A 1 74 SER 74 830 830 SER SER A . n A 1 75 ASP 75 831 831 ASP ASP A . n A 1 76 GLU 76 832 832 GLU GLU A . n A 1 77 ASP 77 833 833 ASP ASP A . n A 1 78 TRP 78 834 834 TRP TRP A . n A 1 79 ASN 79 835 835 ASN ASN A . n A 1 80 VAL 80 836 836 VAL VAL A . n A 1 81 ALA 81 837 837 ALA ALA A . n A 1 82 LYS 82 838 838 LYS LYS A . n A 1 83 GLU 83 839 839 GLU GLU A . n A 1 84 MET 84 840 840 MET MET A . n A 1 85 LEU 85 841 841 LEU LEU A . n A 1 86 ALA 86 842 842 ALA ALA A . n A 1 87 GLU 87 843 843 GLU GLU A . n A 1 88 ASN 88 844 844 ASN ASN A . n A 1 89 ASN 89 845 845 ASN ASN A . n A 1 90 GLU 90 846 846 GLU GLU A . n A 1 91 LYS 91 847 847 LYS LYS A . n A 1 92 PHE 92 848 848 PHE PHE A . n A 1 93 LEU 93 849 849 LEU LEU A . n A 1 94 ASN 94 850 850 ASN ASN A . n A 1 95 ILE 95 851 851 ILE ILE A . n A 1 96 ARG 96 852 852 ARG ARG A . n A 1 97 LEU 97 853 853 LEU LEU A . n A 1 98 TYR 98 854 854 TYR TYR A . n # _exptl.entry_id 1Q1O _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1Q1O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1Q1O _struct.title 'Solution Structure of the PB1 Domain of Cdc24p (Long Form)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Q1O _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDC24_YEAST _struct_ref.pdbx_db_accession P11433 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SILFRISYNNNSNNTSSSEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEM LAENNEKFLNIRLY ; _struct_ref.pdbx_align_begin 761 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Q1O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11433 _struct_ref_seq.db_align_beg 761 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 854 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 761 _struct_ref_seq.pdbx_auth_seq_align_end 854 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1Q1O GLY A 1 ? UNP P11433 ? ? 'cloning artifact' 757 1 1 1Q1O PRO A 2 ? UNP P11433 ? ? 'cloning artifact' 758 2 1 1Q1O LEU A 3 ? UNP P11433 ? ? 'cloning artifact' 759 3 1 1Q1O GLY A 4 ? UNP P11433 ? ? 'cloning artifact' 760 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 34 ? HIS A 50 ? ASN A 790 HIS A 806 1 ? 17 HELX_P HELX_P2 2 SER A 74 ? ASN A 88 ? SER A 830 ASN A 844 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 23 ? VAL A 29 ? GLU A 779 VAL A 785 A 2 ILE A 6 ? TYR A 12 ? ILE A 762 TYR A 768 A 3 PHE A 92 ? LEU A 97 ? PHE A 848 LEU A 853 A 4 ILE A 60 ? GLN A 63 ? ILE A 816 GLN A 819 A 5 PHE A 69 ? LEU A 72 ? PHE A 825 LEU A 828 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 29 ? O VAL A 785 N ILE A 6 ? N ILE A 762 A 2 3 N ARG A 9 ? N ARG A 765 O LEU A 93 ? O LEU A 849 A 3 4 O ARG A 96 ? O ARG A 852 N LYS A 61 ? N LYS A 817 A 4 5 N TYR A 62 ? N TYR A 818 O VAL A 70 ? O VAL A 826 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 772 ? ? 56.94 88.01 2 1 SER A 776 ? ? -161.15 -16.03 3 1 SER A 777 ? ? 56.24 85.32 4 1 THR A 814 ? ? -144.28 11.79 5 1 GLU A 846 ? ? -66.71 -171.72 6 1 LYS A 847 ? ? -157.78 -27.95 7 2 SER A 761 ? ? -121.40 -168.41 8 2 ASN A 773 ? ? 58.47 78.73 9 2 THR A 775 ? ? -134.70 -70.88 10 2 SER A 776 ? ? -151.72 54.39 11 2 SER A 803 ? ? -103.12 59.63 12 2 ASN A 804 ? ? -141.54 -41.93 13 2 HIS A 806 ? ? -76.91 -168.65 14 2 ASN A 807 ? ? -59.39 -72.03 15 2 ASN A 808 ? ? -140.79 -74.74 16 2 PRO A 812 ? ? -57.84 176.84 17 2 LYS A 815 ? ? -165.90 93.19 18 2 ASP A 820 ? ? -113.27 -164.72 19 2 LYS A 847 ? ? -147.69 -28.04 20 3 SER A 761 ? ? 60.99 174.77 21 3 ASN A 771 ? ? -109.52 -159.90 22 3 SER A 772 ? ? -130.18 -55.00 23 3 SER A 776 ? ? -166.87 105.75 24 3 SER A 777 ? ? -145.27 18.99 25 3 ASN A 804 ? ? -174.58 -35.02 26 3 THR A 805 ? ? -101.70 -161.60 27 3 HIS A 806 ? ? 59.31 -165.85 28 3 ASN A 808 ? ? -124.50 -85.00 29 3 ASN A 809 ? ? -171.28 136.50 30 3 THR A 814 ? ? -148.08 -56.00 31 3 ASN A 845 ? ? 59.11 14.92 32 4 ASN A 771 ? ? -105.98 -78.12 33 4 SER A 772 ? ? -158.53 -68.59 34 4 ASN A 773 ? ? -168.49 -4.27 35 4 SER A 776 ? ? 57.16 -167.91 36 4 ASN A 804 ? ? -164.25 -32.95 37 4 PRO A 812 ? ? -66.67 -176.74 38 4 ASN A 845 ? ? 58.24 16.56 39 5 SER A 761 ? ? 59.64 -177.38 40 5 SER A 772 ? ? -162.96 92.16 41 5 ASN A 774 ? ? 54.38 -163.88 42 5 SER A 776 ? ? -157.65 88.23 43 5 SER A 777 ? ? 63.67 159.50 44 5 ASN A 808 ? ? -164.08 7.38 45 6 PRO A 758 ? ? -71.52 -90.35 46 6 LEU A 759 ? ? -157.12 -30.31 47 6 SER A 772 ? ? 57.26 -170.72 48 6 ASN A 773 ? ? 55.50 86.65 49 6 ASN A 774 ? ? 59.53 -170.11 50 6 SER A 776 ? ? -161.55 -56.65 51 6 SER A 777 ? ? -162.25 79.35 52 6 THR A 805 ? ? -165.48 -38.80 53 6 PRO A 812 ? ? -67.70 -179.50 54 6 LYS A 847 ? ? -155.11 12.39 55 7 ASN A 771 ? ? -102.66 -77.14 56 7 SER A 772 ? ? -166.14 79.00 57 7 SER A 777 ? ? -140.58 27.93 58 7 TRP A 789 ? ? -78.25 -165.70 59 7 HIS A 806 ? ? 59.66 -163.61 60 7 ASN A 807 ? ? -149.28 18.97 61 7 ASP A 820 ? ? -102.29 -168.66 62 8 ASN A 771 ? ? -106.68 -65.10 63 8 SER A 772 ? ? -166.53 -65.48 64 8 ASN A 773 ? ? -161.21 23.59 65 8 SER A 776 ? ? -100.28 -161.42 66 8 SER A 777 ? ? 58.42 88.49 67 8 SER A 803 ? ? -84.99 32.24 68 8 THR A 805 ? ? -135.65 -39.88 69 8 PRO A 812 ? ? -55.22 171.75 70 8 ILE A 813 ? ? -84.55 -91.34 71 8 THR A 814 ? ? 59.42 10.91 72 8 LYS A 815 ? ? -174.32 130.70 73 9 ASN A 770 ? ? 57.16 -91.98 74 9 ASN A 771 ? ? -94.11 -76.83 75 9 SER A 772 ? ? -164.45 89.76 76 9 ASN A 773 ? ? 55.30 78.73 77 9 THR A 805 ? ? -156.16 -65.48 78 9 ILE A 813 ? ? 60.05 98.82 79 9 ASP A 820 ? ? -77.37 -168.63 80 10 ASN A 770 ? ? -120.86 -53.91 81 10 ASN A 771 ? ? -150.26 43.10 82 10 ASN A 773 ? ? -157.16 -40.63 83 10 ASN A 774 ? ? 60.86 175.23 84 10 SER A 776 ? ? -158.75 59.70 85 10 SER A 777 ? ? 62.09 174.52 86 10 ASN A 844 ? ? -140.29 -3.13 87 10 GLU A 846 ? ? -67.81 98.95 88 11 LEU A 759 ? ? 58.17 -167.41 89 11 ASN A 770 ? ? 56.92 17.27 90 11 ASN A 771 ? ? -171.69 -164.56 91 11 ASN A 804 ? ? -90.19 -66.18 92 11 ASN A 808 ? ? -96.92 33.84 93 11 ILE A 810 ? ? -110.08 -168.66 94 11 ILE A 813 ? ? 63.05 107.54 95 11 GLU A 846 ? ? -67.71 -174.74 96 11 LYS A 847 ? ? -149.64 -29.31 97 12 SER A 761 ? ? 65.36 158.34 98 12 SER A 772 ? ? 57.08 73.19 99 12 SER A 776 ? ? -160.46 -59.23 100 12 HIS A 806 ? ? 60.57 97.06 101 12 ASN A 807 ? ? 58.94 -167.08 102 12 ASN A 808 ? ? -79.99 -79.85 103 12 ILE A 813 ? ? 65.38 125.53 104 13 SER A 761 ? ? 60.25 173.04 105 13 ASN A 770 ? ? -56.99 103.36 106 13 ASN A 771 ? ? 59.19 -90.66 107 13 SER A 772 ? ? -167.13 71.63 108 13 ASN A 774 ? ? -95.04 45.22 109 13 SER A 776 ? ? 58.29 -166.88 110 14 SER A 761 ? ? 62.02 172.94 111 14 ASN A 770 ? ? 55.54 77.88 112 14 SER A 772 ? ? 57.87 -166.29 113 14 THR A 775 ? ? -155.14 22.33 114 14 ASN A 790 ? ? -121.21 -161.79 115 14 HIS A 806 ? ? 60.48 -171.61 116 14 ASN A 809 ? ? -142.92 15.46 117 14 ASN A 845 ? ? 58.75 17.06 118 15 ASN A 773 ? ? 65.51 135.26 119 15 ASN A 774 ? ? 56.66 -166.31 120 15 SER A 776 ? ? -154.53 -76.12 121 15 ASN A 809 ? ? 57.70 90.42 122 15 ILE A 810 ? ? -74.91 -165.02 123 15 ILE A 813 ? ? 60.01 106.11 124 15 LYS A 847 ? ? -145.09 -25.03 125 16 PRO A 758 ? ? -76.56 -161.71 126 16 ASN A 774 ? ? 59.32 93.69 127 16 THR A 775 ? ? 36.53 44.07 128 16 THR A 805 ? ? -127.37 -50.27 129 16 LYS A 847 ? ? -153.63 -27.71 130 17 ASN A 769 ? ? -112.51 55.19 131 17 ASN A 770 ? ? 60.67 -88.79 132 17 ASN A 807 ? ? -84.47 -88.27 133 17 ASN A 808 ? ? -164.72 -13.17 134 17 ILE A 813 ? ? -105.95 -89.71 135 17 THR A 814 ? ? 58.32 18.12 136 17 LYS A 815 ? ? -169.41 118.17 137 17 ASN A 845 ? ? 59.00 18.32 138 18 LEU A 759 ? ? -100.31 -61.44 139 18 SER A 772 ? ? 60.81 99.65 140 18 ASN A 773 ? ? 57.47 77.10 141 18 SER A 777 ? ? -156.43 19.97 142 18 ASN A 807 ? ? 59.22 -88.83 143 18 ASN A 809 ? ? 59.59 93.93 144 18 THR A 814 ? ? -133.52 -42.04 145 18 GLU A 846 ? ? -68.96 -164.77 146 18 LYS A 847 ? ? -166.07 -27.34 147 19 ASN A 771 ? ? -143.27 -55.65 148 19 SER A 772 ? ? -156.22 -155.60 149 19 ASN A 774 ? ? -78.60 -161.96 150 19 THR A 775 ? ? 53.16 -161.44 151 19 SER A 777 ? ? 56.76 -168.45 152 19 ASN A 790 ? ? -119.89 -168.37 153 19 HIS A 806 ? ? 55.77 -99.74 154 19 ILE A 813 ? ? -112.69 -88.05 155 19 THR A 814 ? ? 56.92 16.85 156 20 SER A 772 ? ? 61.09 170.40 157 20 ASN A 774 ? ? -100.21 -63.97 158 20 THR A 775 ? ? -156.54 -73.38 159 20 SER A 776 ? ? -168.14 -33.59 160 20 GLU A 779 ? ? -109.92 71.72 161 20 HIS A 806 ? ? 51.09 82.27 162 20 ASN A 807 ? ? -117.05 52.54 163 20 ASN A 808 ? ? 62.97 164.66 164 20 ASP A 820 ? ? -105.86 -165.14 165 20 GLU A 846 ? ? -66.29 -174.76 166 20 LYS A 847 ? ? -147.70 -30.48 # _pdbx_nmr_ensemble.entry_id 1Q1O _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1Q1O _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM Cdc24p PB1 U-15N ,13C; 50mM potassium phosphate buffer; 150mM sodium chloride; 1mM sodium azide; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1mM Cdc24p PB1 U-15N, 13C; 50mM potassium phosphate buffer; 150mM sodium chloride; 1mM sodium azide; 100% D2O' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM potassium phosphate buffer; 150mM sodium chloride' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 1 3D_13C-separated_NOESY # _pdbx_nmr_refine.entry_id 1Q1O _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR ? collection ? 1 NMRPipe ? processing ? 2 Olivia ? 'data analysis' ? 3 ARIA ? refinement ;J.P.Linge, S.I.O'Donoghue, M.Nilges ; 4 ARIA ? 'structure solution' ? 5 CNS ? 'structure solution' ? 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian UNITYPLUS 600 2 ? Varian INOVA 500 # _atom_sites.entry_id 1Q1O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_