data_1Q8D # _entry.id 1Q8D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1Q8D RCSB RCSB020044 WWPDB D_1000020044 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Q8D _pdbx_database_status.recvd_initial_deposition_date 2003-08-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Leppanen, V.M.' 1 'Bespalov, M.M.' 2 'Runeberg-Roos, P.' 3 'Puurand, U.' 4 'Merits, A.' 5 'Saarma, M.' 6 'Goldman, A.' 7 # _citation.id primary _citation.title 'The structure of GFRalpha1 domain 3 reveals new insights into GDNF binding and RET activation.' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 23 _citation.page_first 1452 _citation.page_last 1462 _citation.year 2004 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15044950 _citation.pdbx_database_id_DOI 10.1038/sj.emboj.7600174 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Leppanen, V.M.' 1 primary 'Bespalov, M.M.' 2 primary 'Runeberg-Roos, P.' 3 primary 'Puurand, U.' 4 primary 'Merits, A.' 5 primary 'Saarma, M.' 6 primary 'Goldman, A.' 7 # _cell.entry_id 1Q8D _cell.length_a 61.334 _cell.length_b 61.334 _cell.length_c 65.154 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1Q8D _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GDNF family receptor alpha 1' 12075.384 1 ? ? 'Domain 3' ? 2 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174 1 ? ? ? ? 3 water nat water 18.015 97 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GFR-alpha 1, GDNF receptor alpha, GDNFR-alpha, TGF-beta related neurotrophic factor receptor 1, RET ligand 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;ERPNCLSLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTV(MSE)TPNYVDSSSLSVAPWCD CSNSGNDLEDCLKFLNFFKDNTCLKNAIQAFG ; _entity_poly.pdbx_seq_one_letter_code_can ;ERPNCLSLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMTPNYVDSSSLSVAPWCDCSNS GNDLEDCLKFLNFFKDNTCLKNAIQAFG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ARG n 1 3 PRO n 1 4 ASN n 1 5 CYS n 1 6 LEU n 1 7 SER n 1 8 LEU n 1 9 GLN n 1 10 ASP n 1 11 SER n 1 12 CYS n 1 13 LYS n 1 14 THR n 1 15 ASN n 1 16 TYR n 1 17 ILE n 1 18 CYS n 1 19 ARG n 1 20 SER n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ASP n 1 25 PHE n 1 26 PHE n 1 27 THR n 1 28 ASN n 1 29 CYS n 1 30 GLN n 1 31 PRO n 1 32 GLU n 1 33 SER n 1 34 ARG n 1 35 SER n 1 36 VAL n 1 37 SER n 1 38 ASN n 1 39 CYS n 1 40 LEU n 1 41 LYS n 1 42 GLU n 1 43 ASN n 1 44 TYR n 1 45 ALA n 1 46 ASP n 1 47 CYS n 1 48 LEU n 1 49 LEU n 1 50 ALA n 1 51 TYR n 1 52 SER n 1 53 GLY n 1 54 LEU n 1 55 ILE n 1 56 GLY n 1 57 THR n 1 58 VAL n 1 59 MSE n 1 60 THR n 1 61 PRO n 1 62 ASN n 1 63 TYR n 1 64 VAL n 1 65 ASP n 1 66 SER n 1 67 SER n 1 68 SER n 1 69 LEU n 1 70 SER n 1 71 VAL n 1 72 ALA n 1 73 PRO n 1 74 TRP n 1 75 CYS n 1 76 ASP n 1 77 CYS n 1 78 SER n 1 79 ASN n 1 80 SER n 1 81 GLY n 1 82 ASN n 1 83 ASP n 1 84 LEU n 1 85 GLU n 1 86 ASP n 1 87 CYS n 1 88 LEU n 1 89 LYS n 1 90 PHE n 1 91 LEU n 1 92 ASN n 1 93 PHE n 1 94 PHE n 1 95 LYS n 1 96 ASP n 1 97 ASN n 1 98 THR n 1 99 CYS n 1 100 LEU n 1 101 LYS n 1 102 ASN n 1 103 ALA n 1 104 ILE n 1 105 GLN n 1 106 ALA n 1 107 PHE n 1 108 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene GFRA1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus Spodoptera _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Sf9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type baculovirus _entity_src_gen.pdbx_host_org_vector pFastBac _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GFRA1_RAT _struct_ref.pdbx_db_accession Q62997 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ERPNCLSLQDSCKTNYICRSRLADFFTNCQPESRSVSNCLKENYADCLLAYSGLIGTVMTPNYVDSSSLSVAPWCDCSNS GNDLEDCLKFLNFFKDNTCLKNAIQAFG ; _struct_ref.pdbx_align_begin 239 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Q8D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q62997 _struct_ref_seq.db_align_beg 239 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 346 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 239 _struct_ref_seq.pdbx_auth_seq_align_end 346 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1Q8D _struct_ref_seq_dif.mon_id MSE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 59 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q62997 _struct_ref_seq_dif.db_mon_id MET _struct_ref_seq_dif.pdbx_seq_db_seq_num 297 _struct_ref_seq_dif.details 'MODIFIED RESIDUE' _struct_ref_seq_dif.pdbx_auth_seq_num 297 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MPD non-polymer . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2' 118.174 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1Q8D _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.93 _exptl_crystal.density_percent_sol 58.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details 'MPD, MES, magnesium chloride, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2002-11-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SAGITALLY FOCUSED DOUBLE Si(111)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9635 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE BW7A' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, Hamburg' _diffrn_source.pdbx_synchrotron_beamline BW7A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9635 # _reflns.entry_id 1Q8D _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20 _reflns.d_resolution_high 1.8 _reflns.number_obs 12986 _reflns.number_all ? _reflns.percent_possible_obs 100 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.051 _reflns.pdbx_netI_over_sigmaI 41.2 _reflns.B_iso_Wilson_estimate 17.2 _reflns.pdbx_redundancy 10.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.86 _reflns_shell.percent_possible_all 99.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.255 _reflns_shell.meanI_over_sigI_obs 9.4 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1300 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1Q8D _refine.ls_number_reflns_obs 12755 _refine.ls_number_reflns_all 12986 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF 333127.07 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.19 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 98.4 _refine.ls_R_factor_obs 0.193 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.193 _refine.ls_R_factor_R_free 0.208 _refine.ls_R_factor_R_free_error 0.008 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 654 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 20.8 _refine.aniso_B[1][1] 1.25 _refine.aniso_B[2][2] 1.25 _refine.aniso_B[3][3] -2.50 _refine.aniso_B[1][2] 1.56 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.351992 _refine.solvent_model_param_bsol 39.4109 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1Q8D _refine_analyze.Luzzati_coordinate_error_obs 0.19 _refine_analyze.Luzzati_sigma_a_obs 0.09 _refine_analyze.Luzzati_d_res_low_obs 5.0 _refine_analyze.Luzzati_coordinate_error_free 0.20 _refine_analyze.Luzzati_sigma_a_free 0.10 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 773 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 105 _refine_hist.number_atoms_total 878 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 19.19 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.004 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.0 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 19.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.72 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.62 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.60 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.69 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 4.15 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.80 _refine_ls_shell.d_res_low 1.91 _refine_ls_shell.number_reflns_R_work 1942 _refine_ls_shell.R_factor_R_work 0.228 _refine_ls_shell.percent_reflns_obs 95.1 _refine_ls_shell.R_factor_R_free 0.231 _refine_ls_shell.R_factor_R_free_error 0.023 _refine_ls_shell.percent_reflns_R_free 5.1 _refine_ls_shell.number_reflns_R_free 104 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM MPD_XPLOR_TOP.TXT 'X-RAY DIFFRACTION' 3 MPD_XPLOR_PAR.TXT ? 'X-RAY DIFFRACTION' # _struct.entry_id 1Q8D _struct.title 'The crystal structure of GDNF family co-receptor alpha 1 domain 3' _struct.pdbx_descriptor 'GDNF family receptor alpha 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Q8D _struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR RECEPTOR' _struct_keywords.text 'all-alpha, cys-rich, HORMONE-GROWTH FACTOR RECEPTOR COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 4 ? THR A 14 ? ASN A 242 THR A 252 1 ? 11 HELX_P HELX_P2 2 ASN A 15 ? CYS A 29 ? ASN A 253 CYS A 267 1 ? 15 HELX_P HELX_P3 3 LEU A 40 ? GLU A 42 ? LEU A 278 GLU A 280 5 ? 3 HELX_P HELX_P4 4 ASN A 43 ? GLY A 53 ? ASN A 281 GLY A 291 1 ? 11 HELX_P HELX_P5 5 SER A 80 ? ASN A 82 ? SER A 318 ASN A 320 5 ? 3 HELX_P HELX_P6 6 ASP A 83 ? ASP A 96 ? ASP A 321 ASP A 334 1 ? 14 HELX_P HELX_P7 7 ASN A 97 ? GLY A 108 ? ASN A 335 GLY A 346 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 243 A CYS 313 1_555 ? ? ? ? ? ? ? 2.039 ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 250 A CYS 256 1_555 ? ? ? ? ? ? ? 2.034 ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 267 A CYS 285 1_555 ? ? ? ? ? ? ? 2.039 ? disulf4 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 99 SG ? ? A CYS 277 A CYS 337 1_555 ? ? ? ? ? ? ? 2.031 ? disulf5 disulf ? ? A CYS 77 SG ? ? ? 1_555 A CYS 87 SG ? ? A CYS 315 A CYS 325 1_555 ? ? ? ? ? ? ? 2.033 ? covale1 covale ? ? A VAL 58 C ? ? ? 1_555 A MSE 59 N ? ? A VAL 296 A MSE 297 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale ? ? A MSE 59 C ? ? ? 1_555 A THR 60 N ? ? A MSE 297 A THR 298 1_555 ? ? ? ? ? ? ? 1.330 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE MPD A 400' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 TYR A 16 ? TYR A 254 . ? 6_655 ? 2 AC1 6 SER A 52 ? SER A 290 . ? 5_554 ? 3 AC1 6 CYS A 77 ? CYS A 315 . ? 1_555 ? 4 AC1 6 SER A 78 ? SER A 316 . ? 1_555 ? 5 AC1 6 LEU A 84 ? LEU A 322 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 432 . ? 1_555 ? # _database_PDB_matrix.entry_id 1Q8D _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1Q8D _atom_sites.fract_transf_matrix[1][1] 0.016304 _atom_sites.fract_transf_matrix[1][2] 0.009413 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018826 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015348 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 239 239 GLU ALA A . n A 1 2 ARG 2 240 240 ARG ARG A . n A 1 3 PRO 3 241 241 PRO PRO A . n A 1 4 ASN 4 242 242 ASN ASN A . n A 1 5 CYS 5 243 243 CYS CYS A . n A 1 6 LEU 6 244 244 LEU LEU A . n A 1 7 SER 7 245 245 SER SER A . n A 1 8 LEU 8 246 246 LEU LEU A . n A 1 9 GLN 9 247 247 GLN GLN A . n A 1 10 ASP 10 248 248 ASP ASP A . n A 1 11 SER 11 249 249 SER SER A . n A 1 12 CYS 12 250 250 CYS CYS A . n A 1 13 LYS 13 251 251 LYS LYS A . n A 1 14 THR 14 252 252 THR THR A . n A 1 15 ASN 15 253 253 ASN ASN A . n A 1 16 TYR 16 254 254 TYR TYR A . n A 1 17 ILE 17 255 255 ILE ILE A . n A 1 18 CYS 18 256 256 CYS CYS A . n A 1 19 ARG 19 257 257 ARG ARG A . n A 1 20 SER 20 258 258 SER SER A . n A 1 21 ARG 21 259 259 ARG ARG A . n A 1 22 LEU 22 260 260 LEU LEU A . n A 1 23 ALA 23 261 261 ALA ALA A . n A 1 24 ASP 24 262 262 ASP ASP A . n A 1 25 PHE 25 263 263 PHE PHE A . n A 1 26 PHE 26 264 264 PHE PHE A . n A 1 27 THR 27 265 265 THR THR A . n A 1 28 ASN 28 266 266 ASN ASN A . n A 1 29 CYS 29 267 267 CYS CYS A . n A 1 30 GLN 30 268 268 GLN GLN A . n A 1 31 PRO 31 269 269 PRO PRO A . n A 1 32 GLU 32 270 270 GLU GLU A . n A 1 33 SER 33 271 271 SER SER A . n A 1 34 ARG 34 272 272 ARG ARG A . n A 1 35 SER 35 273 273 SER SER A . n A 1 36 VAL 36 274 274 VAL VAL A . n A 1 37 SER 37 275 275 SER SER A . n A 1 38 ASN 38 276 276 ASN ASN A . n A 1 39 CYS 39 277 277 CYS CYS A . n A 1 40 LEU 40 278 278 LEU LEU A . n A 1 41 LYS 41 279 279 LYS LYS A . n A 1 42 GLU 42 280 280 GLU GLU A . n A 1 43 ASN 43 281 281 ASN ASN A . n A 1 44 TYR 44 282 282 TYR TYR A . n A 1 45 ALA 45 283 283 ALA ALA A . n A 1 46 ASP 46 284 284 ASP ASP A . n A 1 47 CYS 47 285 285 CYS CYS A . n A 1 48 LEU 48 286 286 LEU LEU A . n A 1 49 LEU 49 287 287 LEU LEU A . n A 1 50 ALA 50 288 288 ALA ALA A . n A 1 51 TYR 51 289 289 TYR TYR A . n A 1 52 SER 52 290 290 SER SER A . n A 1 53 GLY 53 291 291 GLY GLY A . n A 1 54 LEU 54 292 292 LEU LEU A . n A 1 55 ILE 55 293 293 ILE ILE A . n A 1 56 GLY 56 294 294 GLY GLY A . n A 1 57 THR 57 295 295 THR THR A . n A 1 58 VAL 58 296 296 VAL VAL A . n A 1 59 MSE 59 297 297 MSE MSE A . n A 1 60 THR 60 298 298 THR THR A . n A 1 61 PRO 61 299 299 PRO PRO A . n A 1 62 ASN 62 300 300 ASN ASN A . n A 1 63 TYR 63 301 ? ? ? A . n A 1 64 VAL 64 302 ? ? ? A . n A 1 65 ASP 65 303 ? ? ? A . n A 1 66 SER 66 304 ? ? ? A . n A 1 67 SER 67 305 ? ? ? A . n A 1 68 SER 68 306 ? ? ? A . n A 1 69 LEU 69 307 ? ? ? A . n A 1 70 SER 70 308 ? ? ? A . n A 1 71 VAL 71 309 309 VAL VAL A . n A 1 72 ALA 72 310 310 ALA ALA A . n A 1 73 PRO 73 311 311 PRO PRO A . n A 1 74 TRP 74 312 312 TRP TRP A . n A 1 75 CYS 75 313 313 CYS CYS A . n A 1 76 ASP 76 314 314 ASP ASP A . n A 1 77 CYS 77 315 315 CYS CYS A . n A 1 78 SER 78 316 316 SER SER A . n A 1 79 ASN 79 317 317 ASN ASN A . n A 1 80 SER 80 318 318 SER SER A . n A 1 81 GLY 81 319 319 GLY GLY A . n A 1 82 ASN 82 320 320 ASN ASN A . n A 1 83 ASP 83 321 321 ASP ASP A . n A 1 84 LEU 84 322 322 LEU LEU A . n A 1 85 GLU 85 323 323 GLU GLU A . n A 1 86 ASP 86 324 324 ASP ASP A . n A 1 87 CYS 87 325 325 CYS CYS A . n A 1 88 LEU 88 326 326 LEU LEU A . n A 1 89 LYS 89 327 327 LYS LYS A . n A 1 90 PHE 90 328 328 PHE PHE A . n A 1 91 LEU 91 329 329 LEU LEU A . n A 1 92 ASN 92 330 330 ASN ASN A . n A 1 93 PHE 93 331 331 PHE PHE A . n A 1 94 PHE 94 332 332 PHE PHE A . n A 1 95 LYS 95 333 333 LYS LYS A . n A 1 96 ASP 96 334 334 ASP ASP A . n A 1 97 ASN 97 335 335 ASN ASN A . n A 1 98 THR 98 336 336 THR THR A . n A 1 99 CYS 99 337 337 CYS CYS A . n A 1 100 LEU 100 338 338 LEU LEU A . n A 1 101 LYS 101 339 339 LYS LYS A . n A 1 102 ASN 102 340 340 ASN ASN A . n A 1 103 ALA 103 341 341 ALA ALA A . n A 1 104 ILE 104 342 342 ILE ILE A . n A 1 105 GLN 105 343 343 GLN GLN A . n A 1 106 ALA 106 344 344 ALA ALA A . n A 1 107 PHE 107 345 345 PHE PHE A . n A 1 108 GLY 108 346 346 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MPD 1 400 400 MPD MPD A . C 3 HOH 1 401 401 HOH WAT A . C 3 HOH 2 402 402 HOH WAT A . C 3 HOH 3 403 403 HOH WAT A . C 3 HOH 4 404 404 HOH WAT A . C 3 HOH 5 405 405 HOH WAT A . C 3 HOH 6 406 406 HOH WAT A . C 3 HOH 7 407 407 HOH WAT A . C 3 HOH 8 408 408 HOH WAT A . C 3 HOH 9 409 409 HOH WAT A . C 3 HOH 10 410 410 HOH WAT A . C 3 HOH 11 411 411 HOH WAT A . C 3 HOH 12 412 412 HOH WAT A . C 3 HOH 13 413 413 HOH WAT A . C 3 HOH 14 414 414 HOH WAT A . C 3 HOH 15 415 415 HOH WAT A . C 3 HOH 16 416 416 HOH WAT A . C 3 HOH 17 417 417 HOH WAT A . C 3 HOH 18 418 418 HOH WAT A . C 3 HOH 19 419 419 HOH WAT A . C 3 HOH 20 420 420 HOH WAT A . C 3 HOH 21 421 421 HOH WAT A . C 3 HOH 22 422 422 HOH WAT A . C 3 HOH 23 423 423 HOH WAT A . C 3 HOH 24 424 424 HOH WAT A . C 3 HOH 25 425 425 HOH WAT A . C 3 HOH 26 426 426 HOH WAT A . C 3 HOH 27 427 427 HOH WAT A . C 3 HOH 28 428 428 HOH WAT A . C 3 HOH 29 429 429 HOH WAT A . C 3 HOH 30 430 430 HOH WAT A . C 3 HOH 31 431 431 HOH WAT A . C 3 HOH 32 432 432 HOH WAT A . C 3 HOH 33 433 433 HOH WAT A . C 3 HOH 34 434 434 HOH WAT A . C 3 HOH 35 435 435 HOH WAT A . C 3 HOH 36 436 436 HOH WAT A . C 3 HOH 37 437 437 HOH WAT A . C 3 HOH 38 438 438 HOH WAT A . C 3 HOH 39 439 439 HOH WAT A . C 3 HOH 40 440 440 HOH WAT A . C 3 HOH 41 441 441 HOH WAT A . C 3 HOH 42 442 442 HOH WAT A . C 3 HOH 43 443 443 HOH WAT A . C 3 HOH 44 444 444 HOH WAT A . C 3 HOH 45 445 445 HOH WAT A . C 3 HOH 46 446 446 HOH WAT A . C 3 HOH 47 447 447 HOH WAT A . C 3 HOH 48 448 448 HOH WAT A . C 3 HOH 49 449 449 HOH WAT A . C 3 HOH 50 450 450 HOH WAT A . C 3 HOH 51 451 451 HOH WAT A . C 3 HOH 52 452 452 HOH WAT A . C 3 HOH 53 453 453 HOH WAT A . C 3 HOH 54 454 454 HOH WAT A . C 3 HOH 55 455 455 HOH WAT A . C 3 HOH 56 456 456 HOH WAT A . C 3 HOH 57 457 457 HOH WAT A . C 3 HOH 58 458 458 HOH WAT A . C 3 HOH 59 459 459 HOH WAT A . C 3 HOH 60 460 460 HOH WAT A . C 3 HOH 61 461 461 HOH WAT A . C 3 HOH 62 462 462 HOH WAT A . C 3 HOH 63 463 463 HOH WAT A . C 3 HOH 64 464 464 HOH WAT A . C 3 HOH 65 465 465 HOH WAT A . C 3 HOH 66 466 466 HOH WAT A . C 3 HOH 67 467 467 HOH WAT A . C 3 HOH 68 468 468 HOH WAT A . C 3 HOH 69 469 469 HOH WAT A . C 3 HOH 70 470 470 HOH WAT A . C 3 HOH 71 471 471 HOH WAT A . C 3 HOH 72 472 472 HOH WAT A . C 3 HOH 73 473 473 HOH WAT A . C 3 HOH 74 474 474 HOH WAT A . C 3 HOH 75 475 475 HOH WAT A . C 3 HOH 76 476 476 HOH WAT A . C 3 HOH 77 477 477 HOH WAT A . C 3 HOH 78 478 478 HOH WAT A . C 3 HOH 79 479 479 HOH WAT A . C 3 HOH 80 480 480 HOH WAT A . C 3 HOH 81 481 481 HOH WAT A . C 3 HOH 82 482 482 HOH WAT A . C 3 HOH 83 483 483 HOH WAT A . C 3 HOH 84 485 485 HOH WAT A . C 3 HOH 85 486 486 HOH WAT A . C 3 HOH 86 487 487 HOH WAT A . C 3 HOH 87 488 488 HOH WAT A . C 3 HOH 88 490 490 HOH WAT A . C 3 HOH 89 491 491 HOH WAT A . C 3 HOH 90 492 492 HOH WAT A . C 3 HOH 91 493 493 HOH WAT A . C 3 HOH 92 494 494 HOH WAT A . C 3 HOH 93 495 495 HOH WAT A . C 3 HOH 94 497 497 HOH WAT A . C 3 HOH 95 500 500 HOH WAT A . C 3 HOH 96 505 505 HOH WAT A . C 3 HOH 97 507 507 HOH WAT A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 59 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 297 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-31 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 CNS phasing 1.1 ? 4 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 239 ? CG ? A GLU 1 CG 2 1 Y 1 A GLU 239 ? CD ? A GLU 1 CD 3 1 Y 1 A GLU 239 ? OE1 ? A GLU 1 OE1 4 1 Y 1 A GLU 239 ? OE2 ? A GLU 1 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TYR 301 ? A TYR 63 2 1 Y 1 A VAL 302 ? A VAL 64 3 1 Y 1 A ASP 303 ? A ASP 65 4 1 Y 1 A SER 304 ? A SER 66 5 1 Y 1 A SER 305 ? A SER 67 6 1 Y 1 A SER 306 ? A SER 68 7 1 Y 1 A LEU 307 ? A LEU 69 8 1 Y 1 A SER 308 ? A SER 70 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 3 water HOH #