data_1Q8H # _entry.id 1Q8H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Q8H pdb_00001q8h 10.2210/pdb1q8h/pdb RCSB RCSB020048 ? ? WWPDB D_1000020048 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2003-11-11 ? 2 'Structure model' 1 1 2008-04-29 ? 3 'Structure model' 1 2 2011-07-13 ? 4 'Structure model' 1 3 2017-10-11 ? 5 'Structure model' 2 0 2019-02-06 ? 6 'Structure model' 2 1 2025-03-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Atomic model' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Source and taxonomy' 10 5 'Structure model' 'Structure summary' 11 6 'Structure model' 'Data collection' 12 6 'Structure model' 'Database references' 13 6 'Structure model' 'Derived calculations' 14 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' atom_site 3 5 'Structure model' chem_comp 4 5 'Structure model' entity 5 5 'Structure model' entity_name_com 6 5 'Structure model' entity_src_nat 7 5 'Structure model' pdbx_struct_mod_residue 8 5 'Structure model' struct_ref 9 5 'Structure model' struct_ref_seq_dif 10 6 'Structure model' chem_comp_atom 11 6 'Structure model' chem_comp_bond 12 6 'Structure model' database_2 13 6 'Structure model' pdbx_entry_details 14 6 'Structure model' pdbx_modification_feature 15 6 'Structure model' pdbx_struct_conn_angle 16 6 'Structure model' struct_conn 17 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.name' 3 5 'Structure model' '_atom_site.occupancy' 4 5 'Structure model' '_entity.pdbx_description' 5 5 'Structure model' '_entity_src_nat.common_name' 6 5 'Structure model' '_entity_src_nat.pdbx_beg_seq_num' 7 5 'Structure model' '_entity_src_nat.pdbx_end_seq_num' 8 5 'Structure model' '_pdbx_struct_mod_residue.details' 9 5 'Structure model' '_struct_ref.db_code' 10 5 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 11 6 'Structure model' '_database_2.pdbx_DOI' 12 6 'Structure model' '_database_2.pdbx_database_accession' 13 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 14 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 15 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 16 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 17 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 18 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 19 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 20 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 21 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 22 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 23 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 24 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 25 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 26 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 27 6 'Structure model' '_pdbx_struct_conn_angle.value' 28 6 'Structure model' '_struct_conn.pdbx_dist_value' 29 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 30 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 31 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 32 6 'Structure model' '_struct_conn.ptnr1_label_asym_id' 33 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 34 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 35 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 36 6 'Structure model' '_struct_conn.ptnr1_symmetry' 37 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 38 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 39 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 40 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 41 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 42 6 'Structure model' '_struct_conn.ptnr2_label_seq_id' 43 6 'Structure model' '_struct_conn.ptnr2_symmetry' 44 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 45 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 46 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Q8H _pdbx_database_status.recvd_initial_deposition_date 2003-08-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hoang, Q.Q.' 1 'Sicheri, F.' 2 'Howard, A.J.' 3 'Yang, D.S.' 4 # _citation.id primary _citation.title 'Bone recognition mechanism of porcine osteocalcin from crystal structure.' _citation.journal_abbrev Nature _citation.journal_volume 425 _citation.page_first 977 _citation.page_last 980 _citation.year 2003 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14586470 _citation.pdbx_database_id_DOI 10.1038/nature02079 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hoang, Q.Q.' 1 ? primary 'Sicheri, F.' 2 ? primary 'Howard, A.J.' 3 ? primary 'Yang, D.S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Osteocalcin 5729.201 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 3 ? ? ? ? 3 water nat water 18.015 61 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bone Gla protein,BGP,Gamma-carboxyglutamic acid-containing protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'YLDHGLGAPAPYPDPL(CGU)PRR(CGU)VC(CGU)LNPDCDELADHIGFQEAYRRFYGIA' _entity_poly.pdbx_seq_one_letter_code_can YLDHGLGAPAPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGIA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 LEU n 1 3 ASP n 1 4 HIS n 1 5 GLY n 1 6 LEU n 1 7 GLY n 1 8 ALA n 1 9 PRO n 1 10 ALA n 1 11 PRO n 1 12 TYR n 1 13 PRO n 1 14 ASP n 1 15 PRO n 1 16 LEU n 1 17 CGU n 1 18 PRO n 1 19 ARG n 1 20 ARG n 1 21 CGU n 1 22 VAL n 1 23 CYS n 1 24 CGU n 1 25 LEU n 1 26 ASN n 1 27 PRO n 1 28 ASP n 1 29 CYS n 1 30 ASP n 1 31 GLU n 1 32 LEU n 1 33 ALA n 1 34 ASP n 1 35 HIS n 1 36 ILE n 1 37 GLY n 1 38 PHE n 1 39 GLN n 1 40 GLU n 1 41 ALA n 1 42 TYR n 1 43 ARG n 1 44 ARG n 1 45 PHE n 1 46 TYR n 1 47 GLY n 1 48 ILE n 1 49 ALA n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 49 _entity_src_nat.common_name Pig _entity_src_nat.pdbx_organism_scientific 'Sus scrofa' _entity_src_nat.pdbx_ncbi_taxonomy_id 9823 _entity_src_nat.genus Sus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CGU 'L-peptide linking' n 'GAMMA-CARBOXY-GLUTAMIC ACID' ? 'C6 H9 N O6' 191.139 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 PRO 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 PRO 11 11 ? ? ? A . n A 1 12 TYR 12 12 ? ? ? A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 CGU 17 17 17 CGU CGU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 CGU 21 21 21 CGU CGU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 CGU 24 24 24 CGU CGU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ALA 49 49 49 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 71 71 CA CA A . C 2 CA 1 72 72 CA CA A . D 2 CA 1 73 73 CA CA A . E 3 HOH 1 74 1 HOH HOH A . E 3 HOH 2 75 2 HOH HOH A . E 3 HOH 3 76 3 HOH HOH A . E 3 HOH 4 77 4 HOH HOH A . E 3 HOH 5 78 5 HOH HOH A . E 3 HOH 6 79 6 HOH HOH A . E 3 HOH 7 80 7 HOH HOH A . E 3 HOH 8 81 8 HOH HOH A . E 3 HOH 9 82 9 HOH HOH A . E 3 HOH 10 83 10 HOH HOH A . E 3 HOH 11 84 11 HOH HOH A . E 3 HOH 12 85 12 HOH HOH A . E 3 HOH 13 86 13 HOH HOH A . E 3 HOH 14 87 14 HOH HOH A . E 3 HOH 15 88 15 HOH HOH A . E 3 HOH 16 89 16 HOH HOH A . E 3 HOH 17 90 17 HOH HOH A . E 3 HOH 18 91 18 HOH HOH A . E 3 HOH 19 92 19 HOH HOH A . E 3 HOH 20 93 20 HOH HOH A . E 3 HOH 21 94 21 HOH HOH A . E 3 HOH 22 95 22 HOH HOH A . E 3 HOH 23 96 23 HOH HOH A . E 3 HOH 24 97 24 HOH HOH A . E 3 HOH 25 98 25 HOH HOH A . E 3 HOH 26 99 26 HOH HOH A . E 3 HOH 27 100 27 HOH HOH A . E 3 HOH 28 101 28 HOH HOH A . E 3 HOH 29 102 29 HOH HOH A . E 3 HOH 30 103 30 HOH HOH A . E 3 HOH 31 104 31 HOH HOH A . E 3 HOH 32 105 33 HOH HOH A . E 3 HOH 33 106 34 HOH HOH A . E 3 HOH 34 107 35 HOH HOH A . E 3 HOH 35 108 36 HOH HOH A . E 3 HOH 36 109 37 HOH HOH A . E 3 HOH 37 110 38 HOH HOH A . E 3 HOH 38 111 39 HOH HOH A . E 3 HOH 39 112 40 HOH HOH A . E 3 HOH 40 113 41 HOH HOH A . E 3 HOH 41 114 42 HOH HOH A . E 3 HOH 42 115 43 HOH HOH A . E 3 HOH 43 116 44 HOH HOH A . E 3 HOH 44 117 45 HOH HOH A . E 3 HOH 45 118 46 HOH HOH A . E 3 HOH 46 119 47 HOH HOH A . E 3 HOH 47 120 48 HOH HOH A . E 3 HOH 48 121 49 HOH HOH A . E 3 HOH 49 122 50 HOH HOH A . E 3 HOH 50 123 51 HOH HOH A . E 3 HOH 51 124 52 HOH HOH A . E 3 HOH 52 125 53 HOH HOH A . E 3 HOH 53 126 54 HOH HOH A . E 3 HOH 54 127 55 HOH HOH A . E 3 HOH 55 128 56 HOH HOH A . E 3 HOH 56 129 57 HOH HOH A . E 3 HOH 57 130 58 HOH HOH A . E 3 HOH 58 131 59 HOH HOH A . E 3 HOH 59 132 60 HOH HOH A . E 3 HOH 60 133 63 HOH HOH A . E 3 HOH 61 134 64 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 MAR345 'data collection' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # _cell.entry_id 1Q8H _cell.length_a 51.491 _cell.length_b 51.491 _cell.length_c 35.389 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1Q8H _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # _exptl.entry_id 1Q8H _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_percent_sol 47.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pdbx_details 'PEG 4000, Calcium Chloride, HEPES, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.7 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.7 # _reflns.entry_id 1Q8H _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 30.0 _reflns.d_resolution_high 2 _reflns.number_obs 6230 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.049 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 17.6 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 94.3 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.214 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1Q8H _refine.ls_number_reflns_obs 6230 _refine.ls_number_reflns_all 6783 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 3.00 _refine.pdbx_data_cutoff_high_absF 462281.14 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.72 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 87.7 _refine.ls_R_factor_obs 0.255 _refine.ls_R_factor_all 0.272 _refine.ls_R_factor_R_work 0.255 _refine.ls_R_factor_R_free 0.283 _refine.ls_R_factor_R_free_error 0.009 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 15.2 _refine.ls_number_reflns_R_free 948 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 37.1 _refine.aniso_B[1][1] 2.05 _refine.aniso_B[2][2] 2.05 _refine.aniso_B[3][3] -4.10 _refine.aniso_B[1][2] 3.91 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.349568 _refine.solvent_model_param_bsol 32.3123 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ISAS _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1Q8H _refine_analyze.Luzzati_coordinate_error_obs 0.31 _refine_analyze.Luzzati_sigma_a_obs 0.27 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.36 _refine_analyze.Luzzati_sigma_a_free 0.35 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 314 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 61 _refine_hist.number_atoms_total 378 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 27.72 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 20.5 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.99 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.13 _refine_ls_shell.number_reflns_R_work 704 _refine_ls_shell.R_factor_R_work 0.306 _refine_ls_shell.percent_reflns_obs 68.6 _refine_ls_shell.R_factor_R_free 0.4 _refine_ls_shell.R_factor_R_free_error 0.039 _refine_ls_shell.percent_reflns_R_free 12.9 _refine_ls_shell.number_reflns_R_free 104 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 3 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 4 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 1Q8H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1Q8H _struct.title 'Crystal structure of porcine osteocalcin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Q8H _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;helix-turn-helix-turn-helix, Paper-clip, hydroxyapatite crystal surface binding protein, calcium binding protein, bone gla protein, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OSTCN_PIG _struct_ref.pdbx_db_accession Q8HYY9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YLDHGLGAPAPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGIA _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Q8H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8HYY9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 49 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 49 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1250 ? 1 MORE -70 ? 1 'SSA (A^2)' 5320 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_557 y,x,-z+2 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 70.7780000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 16 ? ASN A 26 ? LEU A 16 ASN A 26 1 ? 11 HELX_P HELX_P2 2 ASN A 26 ? GLY A 37 ? ASN A 26 GLY A 37 1 ? 12 HELX_P HELX_P3 3 GLY A 37 ? GLY A 47 ? GLY A 37 GLY A 47 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 23 A CYS 29 1_555 ? ? ? ? ? ? ? 2.037 ? ? covale1 covale both ? A LEU 16 C ? ? ? 1_555 A CGU 17 N ? ? A LEU 16 A CGU 17 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A CGU 17 C ? ? ? 1_555 A PRO 18 N ? ? A CGU 17 A PRO 18 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale3 covale both ? A ARG 20 C ? ? ? 1_555 A CGU 21 N ? ? A ARG 20 A CGU 21 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale4 covale both ? A CGU 21 C ? ? ? 1_555 A VAL 22 N ? ? A CGU 21 A VAL 22 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale5 covale both ? A CYS 23 C ? ? ? 1_555 A CGU 24 N ? ? A CYS 23 A CGU 24 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale6 covale both ? A CGU 24 C ? ? ? 1_555 A LEU 25 N ? ? A CGU 24 A LEU 25 1_555 ? ? ? ? ? ? ? 1.328 ? ? metalc1 metalc ? ? A CGU 17 OE22 ? ? ? 4_557 B CA . CA ? ? A CGU 17 A CA 71 1_555 ? ? ? ? ? ? ? 2.366 ? ? metalc2 metalc ? ? A CGU 17 OE12 ? ? ? 4_557 B CA . CA ? ? A CGU 17 A CA 71 1_555 ? ? ? ? ? ? ? 2.582 ? ? metalc3 metalc ? ? A CGU 17 OE22 ? ? ? 4_557 C CA . CA ? ? A CGU 17 A CA 72 1_555 ? ? ? ? ? ? ? 2.375 ? ? metalc4 metalc ? ? A CGU 17 OE21 ? ? ? 4_557 C CA . CA ? ? A CGU 17 A CA 72 1_555 ? ? ? ? ? ? ? 3.153 ? ? metalc5 metalc ? ? A CGU 21 OE11 ? ? ? 4_557 B CA . CA ? ? A CGU 21 A CA 71 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc6 metalc ? ? A CGU 21 OE22 ? ? ? 4_557 B CA . CA ? ? A CGU 21 A CA 71 1_555 ? ? ? ? ? ? ? 2.982 ? ? metalc7 metalc ? ? A CGU 21 OE11 ? ? ? 1_555 D CA . CA ? ? A CGU 21 A CA 73 1_555 ? ? ? ? ? ? ? 2.822 ? ? metalc8 metalc ? ? A CGU 21 OE11 ? ? ? 4_557 D CA . CA ? ? A CGU 21 A CA 73 1_555 ? ? ? ? ? ? ? 2.765 ? ? metalc9 metalc ? ? A CGU 24 OE11 ? ? ? 1_555 B CA . CA ? ? A CGU 24 A CA 71 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc10 metalc ? ? A CGU 24 OE22 ? ? ? 1_555 B CA . CA ? ? A CGU 24 A CA 71 1_555 ? ? ? ? ? ? ? 2.536 ? ? metalc11 metalc ? ? A CGU 24 OE11 ? ? ? 1_555 C CA . CA ? ? A CGU 24 A CA 72 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc12 metalc ? ? A CGU 24 OE12 ? ? ? 1_555 C CA . CA ? ? A CGU 24 A CA 72 1_555 ? ? ? ? ? ? ? 2.718 ? ? metalc13 metalc ? ? A CGU 24 OE21 ? ? ? 1_555 D CA . CA ? ? A CGU 24 A CA 73 1_555 ? ? ? ? ? ? ? 2.976 ? ? metalc14 metalc ? ? A CGU 24 OE22 ? ? ? 1_555 D CA . CA ? ? A CGU 24 A CA 73 1_555 ? ? ? ? ? ? ? 2.518 ? ? metalc15 metalc ? ? A CGU 24 OE21 ? ? ? 4_557 D CA . CA ? ? A CGU 24 A CA 73 1_555 ? ? ? ? ? ? ? 2.947 ? ? metalc16 metalc ? ? A CGU 24 OE22 ? ? ? 4_557 D CA . CA ? ? A CGU 24 A CA 73 1_555 ? ? ? ? ? ? ? 2.531 ? ? metalc17 metalc ? ? A ASP 30 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 30 A CA 72 1_555 ? ? ? ? ? ? ? 2.495 ? ? metalc18 metalc ? ? B CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 71 A HOH 87 1_555 ? ? ? ? ? ? ? 2.573 ? ? metalc19 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 72 A HOH 88 1_555 ? ? ? ? ? ? ? 2.082 ? ? metalc20 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 72 A HOH 97 1_555 ? ? ? ? ? ? ? 2.646 ? ? metalc21 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 72 A HOH 118 1_555 ? ? ? ? ? ? ? 2.391 ? ? metalc22 metalc ? ? D CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 73 A HOH 93 1_555 ? ? ? ? ? ? ? 2.370 ? ? metalc23 metalc ? ? D CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 73 A HOH 93 4_557 ? ? ? ? ? ? ? 2.335 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 67.0 ? 2 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 139.6 ? 3 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 74.3 ? 4 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 95.0 ? 5 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 88.6 ? 6 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 72.3 ? 7 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 74.1 ? 8 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 123.4 ? 9 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 141.1 ? 10 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 135.1 ? 11 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 113.3 ? 12 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 88.6 ? 13 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 75.9 ? 14 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 147.6 ? 15 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 70.9 ? 16 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 O ? E HOH . ? A HOH 87 ? 1_555 130.7 ? 17 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 O ? E HOH . ? A HOH 87 ? 1_555 152.5 ? 18 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 O ? E HOH . ? A HOH 87 ? 1_555 82.1 ? 19 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 O ? E HOH . ? A HOH 87 ? 1_555 70.5 ? 20 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 O ? E HOH . ? A HOH 87 ? 1_555 84.0 ? 21 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 O ? E HOH . ? A HOH 87 ? 1_555 99.5 ? 22 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 43.3 ? 23 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 76.2 ? 24 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 119.5 ? 25 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 107.4 ? 26 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 135.7 ? 27 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 50.9 ? 28 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 158.1 ? 29 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 141.2 ? 30 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 94.2 ? 31 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 79.8 ? 32 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 88 ? 1_555 85.1 ? 33 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 88 ? 1_555 94.0 ? 34 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 88 ? 1_555 77.8 ? 35 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 88 ? 1_555 119.5 ? 36 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 88 ? 1_555 73.6 ? 37 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 97 ? 1_555 90.4 ? 38 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 97 ? 1_555 49.1 ? 39 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 97 ? 1_555 159.1 ? 40 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 97 ? 1_555 150.0 ? 41 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 97 ? 1_555 92.6 ? 42 O ? E HOH . ? A HOH 88 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 97 ? 1_555 85.2 ? 43 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 118 ? 1_555 136.8 ? 44 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 118 ? 1_555 103.3 ? 45 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 118 ? 1_555 127.0 ? 46 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 118 ? 1_555 76.9 ? 47 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 118 ? 1_555 64.5 ? 48 O ? E HOH . ? A HOH 88 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 118 ? 1_555 131.4 ? 49 O ? E HOH . ? A HOH 97 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 118 ? 1_555 73.6 ? 50 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 148.8 ? 51 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 74.8 ? 52 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 98.8 ? 53 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 119.3 ? 54 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 66.1 ? 55 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 45.5 ? 56 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 98.2 ? 57 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 76.1 ? 58 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 157.7 ? 59 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 140.9 ? 60 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 65.1 ? 61 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 121.0 ? 62 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 138.5 ? 63 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 161.0 ? 64 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 45.8 ? 65 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 1_555 75.4 ? 66 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 1_555 129.9 ? 67 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 1_555 63.8 ? 68 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 1_555 69.9 ? 69 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 1_555 135.8 ? 70 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 1_555 95.1 ? 71 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 128.8 ? 72 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 77.0 ? 73 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 136.1 ? 74 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 96.3 ? 75 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 64.6 ? 76 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 70.2 ? 77 O ? E HOH . ? A HOH 93 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 85.4 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CGU A 17 ? . . . . CGU A 17 ? 1_555 . . . . . . . GLU 1 CGU Carboxylation 'Named protein modification' 2 CGU A 21 ? . . . . CGU A 21 ? 1_555 . . . . . . . GLU 1 CGU Carboxylation 'Named protein modification' 3 CGU A 24 ? . . . . CGU A 24 ? 1_555 . . . . . . . GLU 1 CGU Carboxylation 'Named protein modification' 4 CYS A 23 ? CYS A 29 ? CYS A 23 ? 1_555 CYS A 29 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 71 ? 4 'BINDING SITE FOR RESIDUE CA A 71' AC2 Software A CA 72 ? 6 'BINDING SITE FOR RESIDUE CA A 72' AC3 Software A CA 73 ? 6 'BINDING SITE FOR RESIDUE CA A 73' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CGU A 17 ? CGU A 17 . ? 4_557 ? 2 AC1 4 CGU A 21 ? CGU A 21 . ? 4_557 ? 3 AC1 4 CGU A 24 ? CGU A 24 . ? 1_555 ? 4 AC1 4 HOH E . ? HOH A 87 . ? 1_555 ? 5 AC2 6 CGU A 17 ? CGU A 17 . ? 4_557 ? 6 AC2 6 CGU A 24 ? CGU A 24 . ? 1_555 ? 7 AC2 6 ASP A 30 ? ASP A 30 . ? 1_555 ? 8 AC2 6 HOH E . ? HOH A 88 . ? 1_555 ? 9 AC2 6 HOH E . ? HOH A 97 . ? 1_555 ? 10 AC2 6 HOH E . ? HOH A 118 . ? 1_555 ? 11 AC3 6 CGU A 21 ? CGU A 21 . ? 1_555 ? 12 AC3 6 CGU A 21 ? CGU A 21 . ? 4_557 ? 13 AC3 6 CGU A 24 ? CGU A 24 . ? 1_555 ? 14 AC3 6 CGU A 24 ? CGU A 24 . ? 4_557 ? 15 AC3 6 HOH E . ? HOH A 93 . ? 4_557 ? 16 AC3 6 HOH E . ? HOH A 93 . ? 1_555 ? # _pdbx_entry_details.entry_id 1Q8H _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 117 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 117 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_556 _pdbx_validate_symm_contact.dist 1.80 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CGU 17 A CGU 17 ? GLU 'modified residue' 2 A CGU 21 A CGU 21 ? GLU 'modified residue' 3 A CGU 24 A CGU 24 ? GLU 'modified residue' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CA _pdbx_struct_special_symmetry.auth_seq_id 73 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id CA _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TYR 1 ? A TYR 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A PRO 9 ? A PRO 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A PRO 11 ? A PRO 11 12 1 Y 1 A TYR 12 ? A TYR 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CGU N N N N 75 CGU CA C N S 76 CGU C C N N 77 CGU O O N N 78 CGU OXT O N N 79 CGU CB C N N 80 CGU CG C N N 81 CGU CD1 C N N 82 CGU CD2 C N N 83 CGU OE11 O N N 84 CGU OE12 O N N 85 CGU OE21 O N N 86 CGU OE22 O N N 87 CGU H H N N 88 CGU H2 H N N 89 CGU HA H N N 90 CGU HXT H N N 91 CGU HB2 H N N 92 CGU HB3 H N N 93 CGU HG H N N 94 CGU HE12 H N N 95 CGU HE22 H N N 96 CYS N N N N 97 CYS CA C N R 98 CYS C C N N 99 CYS O O N N 100 CYS CB C N N 101 CYS SG S N N 102 CYS OXT O N N 103 CYS H H N N 104 CYS H2 H N N 105 CYS HA H N N 106 CYS HB2 H N N 107 CYS HB3 H N N 108 CYS HG H N N 109 CYS HXT H N N 110 GLN N N N N 111 GLN CA C N S 112 GLN C C N N 113 GLN O O N N 114 GLN CB C N N 115 GLN CG C N N 116 GLN CD C N N 117 GLN OE1 O N N 118 GLN NE2 N N N 119 GLN OXT O N N 120 GLN H H N N 121 GLN H2 H N N 122 GLN HA H N N 123 GLN HB2 H N N 124 GLN HB3 H N N 125 GLN HG2 H N N 126 GLN HG3 H N N 127 GLN HE21 H N N 128 GLN HE22 H N N 129 GLN HXT H N N 130 GLU N N N N 131 GLU CA C N S 132 GLU C C N N 133 GLU O O N N 134 GLU CB C N N 135 GLU CG C N N 136 GLU CD C N N 137 GLU OE1 O N N 138 GLU OE2 O N N 139 GLU OXT O N N 140 GLU H H N N 141 GLU H2 H N N 142 GLU HA H N N 143 GLU HB2 H N N 144 GLU HB3 H N N 145 GLU HG2 H N N 146 GLU HG3 H N N 147 GLU HE2 H N N 148 GLU HXT H N N 149 GLY N N N N 150 GLY CA C N N 151 GLY C C N N 152 GLY O O N N 153 GLY OXT O N N 154 GLY H H N N 155 GLY H2 H N N 156 GLY HA2 H N N 157 GLY HA3 H N N 158 GLY HXT H N N 159 HIS N N N N 160 HIS CA C N S 161 HIS C C N N 162 HIS O O N N 163 HIS CB C N N 164 HIS CG C Y N 165 HIS ND1 N Y N 166 HIS CD2 C Y N 167 HIS CE1 C Y N 168 HIS NE2 N Y N 169 HIS OXT O N N 170 HIS H H N N 171 HIS H2 H N N 172 HIS HA H N N 173 HIS HB2 H N N 174 HIS HB3 H N N 175 HIS HD1 H N N 176 HIS HD2 H N N 177 HIS HE1 H N N 178 HIS HE2 H N N 179 HIS HXT H N N 180 HOH O O N N 181 HOH H1 H N N 182 HOH H2 H N N 183 ILE N N N N 184 ILE CA C N S 185 ILE C C N N 186 ILE O O N N 187 ILE CB C N S 188 ILE CG1 C N N 189 ILE CG2 C N N 190 ILE CD1 C N N 191 ILE OXT O N N 192 ILE H H N N 193 ILE H2 H N N 194 ILE HA H N N 195 ILE HB H N N 196 ILE HG12 H N N 197 ILE HG13 H N N 198 ILE HG21 H N N 199 ILE HG22 H N N 200 ILE HG23 H N N 201 ILE HD11 H N N 202 ILE HD12 H N N 203 ILE HD13 H N N 204 ILE HXT H N N 205 LEU N N N N 206 LEU CA C N S 207 LEU C C N N 208 LEU O O N N 209 LEU CB C N N 210 LEU CG C N N 211 LEU CD1 C N N 212 LEU CD2 C N N 213 LEU OXT O N N 214 LEU H H N N 215 LEU H2 H N N 216 LEU HA H N N 217 LEU HB2 H N N 218 LEU HB3 H N N 219 LEU HG H N N 220 LEU HD11 H N N 221 LEU HD12 H N N 222 LEU HD13 H N N 223 LEU HD21 H N N 224 LEU HD22 H N N 225 LEU HD23 H N N 226 LEU HXT H N N 227 PHE N N N N 228 PHE CA C N S 229 PHE C C N N 230 PHE O O N N 231 PHE CB C N N 232 PHE CG C Y N 233 PHE CD1 C Y N 234 PHE CD2 C Y N 235 PHE CE1 C Y N 236 PHE CE2 C Y N 237 PHE CZ C Y N 238 PHE OXT O N N 239 PHE H H N N 240 PHE H2 H N N 241 PHE HA H N N 242 PHE HB2 H N N 243 PHE HB3 H N N 244 PHE HD1 H N N 245 PHE HD2 H N N 246 PHE HE1 H N N 247 PHE HE2 H N N 248 PHE HZ H N N 249 PHE HXT H N N 250 PRO N N N N 251 PRO CA C N S 252 PRO C C N N 253 PRO O O N N 254 PRO CB C N N 255 PRO CG C N N 256 PRO CD C N N 257 PRO OXT O N N 258 PRO H H N N 259 PRO HA H N N 260 PRO HB2 H N N 261 PRO HB3 H N N 262 PRO HG2 H N N 263 PRO HG3 H N N 264 PRO HD2 H N N 265 PRO HD3 H N N 266 PRO HXT H N N 267 TYR N N N N 268 TYR CA C N S 269 TYR C C N N 270 TYR O O N N 271 TYR CB C N N 272 TYR CG C Y N 273 TYR CD1 C Y N 274 TYR CD2 C Y N 275 TYR CE1 C Y N 276 TYR CE2 C Y N 277 TYR CZ C Y N 278 TYR OH O N N 279 TYR OXT O N N 280 TYR H H N N 281 TYR H2 H N N 282 TYR HA H N N 283 TYR HB2 H N N 284 TYR HB3 H N N 285 TYR HD1 H N N 286 TYR HD2 H N N 287 TYR HE1 H N N 288 TYR HE2 H N N 289 TYR HH H N N 290 TYR HXT H N N 291 VAL N N N N 292 VAL CA C N S 293 VAL C C N N 294 VAL O O N N 295 VAL CB C N N 296 VAL CG1 C N N 297 VAL CG2 C N N 298 VAL OXT O N N 299 VAL H H N N 300 VAL H2 H N N 301 VAL HA H N N 302 VAL HB H N N 303 VAL HG11 H N N 304 VAL HG12 H N N 305 VAL HG13 H N N 306 VAL HG21 H N N 307 VAL HG22 H N N 308 VAL HG23 H N N 309 VAL HXT H N N 310 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CGU N CA sing N N 70 CGU N H sing N N 71 CGU N H2 sing N N 72 CGU CA C sing N N 73 CGU CA CB sing N N 74 CGU CA HA sing N N 75 CGU C O doub N N 76 CGU C OXT sing N N 77 CGU OXT HXT sing N N 78 CGU CB CG sing N N 79 CGU CB HB2 sing N N 80 CGU CB HB3 sing N N 81 CGU CG CD1 sing N N 82 CGU CG CD2 sing N N 83 CGU CG HG sing N N 84 CGU CD1 OE11 doub N N 85 CGU CD1 OE12 sing N N 86 CGU CD2 OE21 doub N N 87 CGU CD2 OE22 sing N N 88 CGU OE12 HE12 sing N N 89 CGU OE22 HE22 sing N N 90 CYS N CA sing N N 91 CYS N H sing N N 92 CYS N H2 sing N N 93 CYS CA C sing N N 94 CYS CA CB sing N N 95 CYS CA HA sing N N 96 CYS C O doub N N 97 CYS C OXT sing N N 98 CYS CB SG sing N N 99 CYS CB HB2 sing N N 100 CYS CB HB3 sing N N 101 CYS SG HG sing N N 102 CYS OXT HXT sing N N 103 GLN N CA sing N N 104 GLN N H sing N N 105 GLN N H2 sing N N 106 GLN CA C sing N N 107 GLN CA CB sing N N 108 GLN CA HA sing N N 109 GLN C O doub N N 110 GLN C OXT sing N N 111 GLN CB CG sing N N 112 GLN CB HB2 sing N N 113 GLN CB HB3 sing N N 114 GLN CG CD sing N N 115 GLN CG HG2 sing N N 116 GLN CG HG3 sing N N 117 GLN CD OE1 doub N N 118 GLN CD NE2 sing N N 119 GLN NE2 HE21 sing N N 120 GLN NE2 HE22 sing N N 121 GLN OXT HXT sing N N 122 GLU N CA sing N N 123 GLU N H sing N N 124 GLU N H2 sing N N 125 GLU CA C sing N N 126 GLU CA CB sing N N 127 GLU CA HA sing N N 128 GLU C O doub N N 129 GLU C OXT sing N N 130 GLU CB CG sing N N 131 GLU CB HB2 sing N N 132 GLU CB HB3 sing N N 133 GLU CG CD sing N N 134 GLU CG HG2 sing N N 135 GLU CG HG3 sing N N 136 GLU CD OE1 doub N N 137 GLU CD OE2 sing N N 138 GLU OE2 HE2 sing N N 139 GLU OXT HXT sing N N 140 GLY N CA sing N N 141 GLY N H sing N N 142 GLY N H2 sing N N 143 GLY CA C sing N N 144 GLY CA HA2 sing N N 145 GLY CA HA3 sing N N 146 GLY C O doub N N 147 GLY C OXT sing N N 148 GLY OXT HXT sing N N 149 HIS N CA sing N N 150 HIS N H sing N N 151 HIS N H2 sing N N 152 HIS CA C sing N N 153 HIS CA CB sing N N 154 HIS CA HA sing N N 155 HIS C O doub N N 156 HIS C OXT sing N N 157 HIS CB CG sing N N 158 HIS CB HB2 sing N N 159 HIS CB HB3 sing N N 160 HIS CG ND1 sing Y N 161 HIS CG CD2 doub Y N 162 HIS ND1 CE1 doub Y N 163 HIS ND1 HD1 sing N N 164 HIS CD2 NE2 sing Y N 165 HIS CD2 HD2 sing N N 166 HIS CE1 NE2 sing Y N 167 HIS CE1 HE1 sing N N 168 HIS NE2 HE2 sing N N 169 HIS OXT HXT sing N N 170 HOH O H1 sing N N 171 HOH O H2 sing N N 172 ILE N CA sing N N 173 ILE N H sing N N 174 ILE N H2 sing N N 175 ILE CA C sing N N 176 ILE CA CB sing N N 177 ILE CA HA sing N N 178 ILE C O doub N N 179 ILE C OXT sing N N 180 ILE CB CG1 sing N N 181 ILE CB CG2 sing N N 182 ILE CB HB sing N N 183 ILE CG1 CD1 sing N N 184 ILE CG1 HG12 sing N N 185 ILE CG1 HG13 sing N N 186 ILE CG2 HG21 sing N N 187 ILE CG2 HG22 sing N N 188 ILE CG2 HG23 sing N N 189 ILE CD1 HD11 sing N N 190 ILE CD1 HD12 sing N N 191 ILE CD1 HD13 sing N N 192 ILE OXT HXT sing N N 193 LEU N CA sing N N 194 LEU N H sing N N 195 LEU N H2 sing N N 196 LEU CA C sing N N 197 LEU CA CB sing N N 198 LEU CA HA sing N N 199 LEU C O doub N N 200 LEU C OXT sing N N 201 LEU CB CG sing N N 202 LEU CB HB2 sing N N 203 LEU CB HB3 sing N N 204 LEU CG CD1 sing N N 205 LEU CG CD2 sing N N 206 LEU CG HG sing N N 207 LEU CD1 HD11 sing N N 208 LEU CD1 HD12 sing N N 209 LEU CD1 HD13 sing N N 210 LEU CD2 HD21 sing N N 211 LEU CD2 HD22 sing N N 212 LEU CD2 HD23 sing N N 213 LEU OXT HXT sing N N 214 PHE N CA sing N N 215 PHE N H sing N N 216 PHE N H2 sing N N 217 PHE CA C sing N N 218 PHE CA CB sing N N 219 PHE CA HA sing N N 220 PHE C O doub N N 221 PHE C OXT sing N N 222 PHE CB CG sing N N 223 PHE CB HB2 sing N N 224 PHE CB HB3 sing N N 225 PHE CG CD1 doub Y N 226 PHE CG CD2 sing Y N 227 PHE CD1 CE1 sing Y N 228 PHE CD1 HD1 sing N N 229 PHE CD2 CE2 doub Y N 230 PHE CD2 HD2 sing N N 231 PHE CE1 CZ doub Y N 232 PHE CE1 HE1 sing N N 233 PHE CE2 CZ sing Y N 234 PHE CE2 HE2 sing N N 235 PHE CZ HZ sing N N 236 PHE OXT HXT sing N N 237 PRO N CA sing N N 238 PRO N CD sing N N 239 PRO N H sing N N 240 PRO CA C sing N N 241 PRO CA CB sing N N 242 PRO CA HA sing N N 243 PRO C O doub N N 244 PRO C OXT sing N N 245 PRO CB CG sing N N 246 PRO CB HB2 sing N N 247 PRO CB HB3 sing N N 248 PRO CG CD sing N N 249 PRO CG HG2 sing N N 250 PRO CG HG3 sing N N 251 PRO CD HD2 sing N N 252 PRO CD HD3 sing N N 253 PRO OXT HXT sing N N 254 TYR N CA sing N N 255 TYR N H sing N N 256 TYR N H2 sing N N 257 TYR CA C sing N N 258 TYR CA CB sing N N 259 TYR CA HA sing N N 260 TYR C O doub N N 261 TYR C OXT sing N N 262 TYR CB CG sing N N 263 TYR CB HB2 sing N N 264 TYR CB HB3 sing N N 265 TYR CG CD1 doub Y N 266 TYR CG CD2 sing Y N 267 TYR CD1 CE1 sing Y N 268 TYR CD1 HD1 sing N N 269 TYR CD2 CE2 doub Y N 270 TYR CD2 HD2 sing N N 271 TYR CE1 CZ doub Y N 272 TYR CE1 HE1 sing N N 273 TYR CE2 CZ sing Y N 274 TYR CE2 HE2 sing N N 275 TYR CZ OH sing N N 276 TYR OH HH sing N N 277 TYR OXT HXT sing N N 278 VAL N CA sing N N 279 VAL N H sing N N 280 VAL N H2 sing N N 281 VAL CA C sing N N 282 VAL CA CB sing N N 283 VAL CA HA sing N N 284 VAL C O doub N N 285 VAL C OXT sing N N 286 VAL CB CG1 sing N N 287 VAL CB CG2 sing N N 288 VAL CB HB sing N N 289 VAL CG1 HG11 sing N N 290 VAL CG1 HG12 sing N N 291 VAL CG1 HG13 sing N N 292 VAL CG2 HG21 sing N N 293 VAL CG2 HG22 sing N N 294 VAL CG2 HG23 sing N N 295 VAL OXT HXT sing N N 296 # _atom_sites.entry_id 1Q8H _atom_sites.fract_transf_matrix[1][1] 0.019421 _atom_sites.fract_transf_matrix[1][2] 0.011213 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022425 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.028257 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_