data_1QHQ # _entry.id 1QHQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1QHQ pdb_00001qhq 10.2210/pdb1qhq/pdb RCSB RCSB001105 ? ? WWPDB D_1000001105 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-03-07 2 'Structure model' 1 1 2007-10-16 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QHQ _pdbx_database_status.recvd_initial_deposition_date 1999-05-25 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bond, C.S.' 1 'Blankenship, R.E.' 2 'Freeman, H.C.' 3 'Guss, J.M.' 4 'Maher, M.' 5 'Selvaraj, F.' 6 'Wilce, M.C.J.' 7 'Willingham, K.' 8 # _citation.id primary _citation.title ;Crystal structure of auracyanin, a "blue" copper protein from the green thermophilic photosynthetic bacterium Chloroflexus aurantiacus. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 306 _citation.page_first 47 _citation.page_last 67 _citation.year 2001 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11178893 _citation.pdbx_database_id_DOI 10.1006/jmbi.2000.4201 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bond, C.S.' 1 ? primary 'Blankenship, R.E.' 2 ? primary 'Freeman, H.C.' 3 ? primary 'Guss, J.M.' 4 ? primary 'Maher, M.J.' 5 ? primary 'Selvaraj, F.M.' 6 ? primary 'Wilce, M.C.' 7 ? primary 'Willingham, K.M.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'PROTEIN (AURACYANIN)' 14410.964 1 ? ? ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 5 water nat water 18.015 247 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AANAPGGSNVVNETPAQTVEVRAAPDALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNA DALFVPPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP ; _entity_poly.pdbx_seq_one_letter_code_can ;AANAPGGSNVVNETPAQTVEVRAAPDALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNA DALFVPPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 'CHLORIDE ION' CL 4 'SULFATE ION' SO4 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ALA n 1 3 ASN n 1 4 ALA n 1 5 PRO n 1 6 GLY n 1 7 GLY n 1 8 SER n 1 9 ASN n 1 10 VAL n 1 11 VAL n 1 12 ASN n 1 13 GLU n 1 14 THR n 1 15 PRO n 1 16 ALA n 1 17 GLN n 1 18 THR n 1 19 VAL n 1 20 GLU n 1 21 VAL n 1 22 ARG n 1 23 ALA n 1 24 ALA n 1 25 PRO n 1 26 ASP n 1 27 ALA n 1 28 LEU n 1 29 ALA n 1 30 PHE n 1 31 ALA n 1 32 GLN n 1 33 THR n 1 34 SER n 1 35 LEU n 1 36 SER n 1 37 LEU n 1 38 PRO n 1 39 ALA n 1 40 ASN n 1 41 THR n 1 42 VAL n 1 43 VAL n 1 44 ARG n 1 45 LEU n 1 46 ASP n 1 47 PHE n 1 48 VAL n 1 49 ASN n 1 50 GLN n 1 51 ASN n 1 52 ASN n 1 53 LEU n 1 54 GLY n 1 55 VAL n 1 56 GLN n 1 57 HIS n 1 58 ASN n 1 59 TRP n 1 60 VAL n 1 61 LEU n 1 62 VAL n 1 63 ASN n 1 64 GLY n 1 65 GLY n 1 66 ASP n 1 67 ASP n 1 68 VAL n 1 69 ALA n 1 70 ALA n 1 71 ALA n 1 72 VAL n 1 73 ASN n 1 74 THR n 1 75 ALA n 1 76 ALA n 1 77 GLN n 1 78 ASN n 1 79 ASN n 1 80 ALA n 1 81 ASP n 1 82 ALA n 1 83 LEU n 1 84 PHE n 1 85 VAL n 1 86 PRO n 1 87 PRO n 1 88 PRO n 1 89 ASP n 1 90 THR n 1 91 PRO n 1 92 ASN n 1 93 ALA n 1 94 LEU n 1 95 ALA n 1 96 TRP n 1 97 THR n 1 98 ALA n 1 99 MET n 1 100 LEU n 1 101 ASN n 1 102 ALA n 1 103 GLY n 1 104 GLU n 1 105 SER n 1 106 GLY n 1 107 SER n 1 108 VAL n 1 109 THR n 1 110 PHE n 1 111 ARG n 1 112 THR n 1 113 PRO n 1 114 ALA n 1 115 PRO n 1 116 GLY n 1 117 THR n 1 118 TYR n 1 119 LEU n 1 120 TYR n 1 121 ILE n 1 122 CYS n 1 123 THR n 1 124 PHE n 1 125 PRO n 1 126 GLY n 1 127 HIS n 1 128 TYR n 1 129 LEU n 1 130 ALA n 1 131 GLY n 1 132 MET n 1 133 LYS n 1 134 GLY n 1 135 THR n 1 136 LEU n 1 137 THR n 1 138 VAL n 1 139 THR n 1 140 PRO n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Chloroflexus aurantiacus' _entity_src_nat.pdbx_ncbi_taxonomy_id 1108 _entity_src_nat.genus Chloroflexus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location 'PERIPHERAL MEMBRANE PROTEIN' _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details 'GREEN GLIDING THERMOPHILIC PHOTOSYNTHETIC BACTERIUM' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 MET 132 132 132 MET MET A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 PRO 140 140 140 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 141 141 CU CU A . C 3 CL 1 142 142 CL CL A . D 4 SO4 1 143 143 SO4 SO4 A . E 4 SO4 1 144 144 SO4 SO4 A . F 5 HOH 1 145 145 HOH HOH A . F 5 HOH 2 146 146 HOH HOH A . F 5 HOH 3 147 147 HOH HOH A . F 5 HOH 4 148 148 HOH HOH A . F 5 HOH 5 149 149 HOH HOH A . F 5 HOH 6 150 150 HOH HOH A . F 5 HOH 7 151 151 HOH HOH A . F 5 HOH 8 152 152 HOH HOH A . F 5 HOH 9 153 153 HOH HOH A . F 5 HOH 10 154 154 HOH HOH A . F 5 HOH 11 155 155 HOH HOH A . F 5 HOH 12 156 156 HOH HOH A . F 5 HOH 13 157 157 HOH HOH A . F 5 HOH 14 158 158 HOH HOH A . F 5 HOH 15 159 159 HOH HOH A . F 5 HOH 16 160 160 HOH HOH A . F 5 HOH 17 161 161 HOH HOH A . F 5 HOH 18 162 162 HOH HOH A . F 5 HOH 19 163 163 HOH HOH A . F 5 HOH 20 164 164 HOH HOH A . F 5 HOH 21 165 165 HOH HOH A . F 5 HOH 22 166 166 HOH HOH A . F 5 HOH 23 167 167 HOH HOH A . F 5 HOH 24 168 168 HOH HOH A . F 5 HOH 25 169 169 HOH HOH A . F 5 HOH 26 170 170 HOH HOH A . F 5 HOH 27 171 171 HOH HOH A . F 5 HOH 28 172 172 HOH HOH A . F 5 HOH 29 173 173 HOH HOH A . F 5 HOH 30 174 174 HOH HOH A . F 5 HOH 31 175 175 HOH HOH A . F 5 HOH 32 176 176 HOH HOH A . F 5 HOH 33 177 177 HOH HOH A . F 5 HOH 34 178 178 HOH HOH A . F 5 HOH 35 179 179 HOH HOH A . F 5 HOH 36 180 180 HOH HOH A . F 5 HOH 37 181 181 HOH HOH A . F 5 HOH 38 182 182 HOH HOH A . F 5 HOH 39 183 183 HOH HOH A . F 5 HOH 40 184 184 HOH HOH A . F 5 HOH 41 185 185 HOH HOH A . F 5 HOH 42 186 186 HOH HOH A . F 5 HOH 43 187 187 HOH HOH A . F 5 HOH 44 188 188 HOH HOH A . F 5 HOH 45 189 189 HOH HOH A . F 5 HOH 46 190 190 HOH HOH A . F 5 HOH 47 191 191 HOH HOH A . F 5 HOH 48 192 192 HOH HOH A . F 5 HOH 49 193 193 HOH HOH A . F 5 HOH 50 194 194 HOH HOH A . F 5 HOH 51 195 195 HOH HOH A . F 5 HOH 52 196 196 HOH HOH A . F 5 HOH 53 197 197 HOH HOH A . F 5 HOH 54 198 198 HOH HOH A . F 5 HOH 55 199 199 HOH HOH A . F 5 HOH 56 200 200 HOH HOH A . F 5 HOH 57 201 201 HOH HOH A . F 5 HOH 58 202 202 HOH HOH A . F 5 HOH 59 203 203 HOH HOH A . F 5 HOH 60 204 204 HOH HOH A . F 5 HOH 61 205 205 HOH HOH A . F 5 HOH 62 206 206 HOH HOH A . F 5 HOH 63 207 207 HOH HOH A . F 5 HOH 64 208 208 HOH HOH A . F 5 HOH 65 209 209 HOH HOH A . F 5 HOH 66 210 210 HOH HOH A . F 5 HOH 67 211 211 HOH HOH A . F 5 HOH 68 212 212 HOH HOH A . F 5 HOH 69 213 213 HOH HOH A . F 5 HOH 70 214 214 HOH HOH A . F 5 HOH 71 215 215 HOH HOH A . F 5 HOH 72 216 216 HOH HOH A . F 5 HOH 73 217 217 HOH HOH A . F 5 HOH 74 218 218 HOH HOH A . F 5 HOH 75 219 219 HOH HOH A . F 5 HOH 76 220 220 HOH HOH A . F 5 HOH 77 221 221 HOH HOH A . F 5 HOH 78 222 222 HOH HOH A . F 5 HOH 79 223 223 HOH HOH A . F 5 HOH 80 224 224 HOH HOH A . F 5 HOH 81 225 225 HOH HOH A . F 5 HOH 82 226 226 HOH HOH A . F 5 HOH 83 227 227 HOH HOH A . F 5 HOH 84 228 228 HOH HOH A . F 5 HOH 85 229 229 HOH HOH A . F 5 HOH 86 230 230 HOH HOH A . F 5 HOH 87 231 231 HOH HOH A . F 5 HOH 88 232 232 HOH HOH A . F 5 HOH 89 233 233 HOH HOH A . F 5 HOH 90 234 234 HOH HOH A . F 5 HOH 91 235 235 HOH HOH A . F 5 HOH 92 236 236 HOH HOH A . F 5 HOH 93 237 237 HOH HOH A . F 5 HOH 94 238 238 HOH HOH A . F 5 HOH 95 239 239 HOH HOH A . F 5 HOH 96 240 240 HOH HOH A . F 5 HOH 97 241 241 HOH HOH A . F 5 HOH 98 242 242 HOH HOH A . F 5 HOH 99 243 243 HOH HOH A . F 5 HOH 100 244 244 HOH HOH A . F 5 HOH 101 245 245 HOH HOH A . F 5 HOH 102 246 246 HOH HOH A . F 5 HOH 103 247 247 HOH HOH A . F 5 HOH 104 248 248 HOH HOH A . F 5 HOH 105 249 249 HOH HOH A . F 5 HOH 106 250 250 HOH HOH A . F 5 HOH 107 251 251 HOH HOH A . F 5 HOH 108 252 252 HOH HOH A . F 5 HOH 109 253 253 HOH HOH A . F 5 HOH 110 254 254 HOH HOH A . F 5 HOH 111 255 255 HOH HOH A . F 5 HOH 112 256 256 HOH HOH A . F 5 HOH 113 257 257 HOH HOH A . F 5 HOH 114 258 258 HOH HOH A . F 5 HOH 115 259 259 HOH HOH A . F 5 HOH 116 260 260 HOH HOH A . F 5 HOH 117 261 261 HOH HOH A . F 5 HOH 118 262 262 HOH HOH A . F 5 HOH 119 263 263 HOH HOH A . F 5 HOH 120 264 264 HOH HOH A . F 5 HOH 121 265 265 HOH HOH A . F 5 HOH 122 266 266 HOH HOH A . F 5 HOH 123 267 267 HOH HOH A . F 5 HOH 124 268 268 HOH HOH A . F 5 HOH 125 269 269 HOH HOH A . F 5 HOH 126 270 270 HOH HOH A . F 5 HOH 127 271 271 HOH HOH A . F 5 HOH 128 272 272 HOH HOH A . F 5 HOH 129 273 273 HOH HOH A . F 5 HOH 130 274 274 HOH HOH A . F 5 HOH 131 275 275 HOH HOH A . F 5 HOH 132 276 276 HOH HOH A . F 5 HOH 133 277 277 HOH HOH A . F 5 HOH 134 278 278 HOH HOH A . F 5 HOH 135 279 279 HOH HOH A . F 5 HOH 136 280 280 HOH HOH A . F 5 HOH 137 281 281 HOH HOH A . F 5 HOH 138 282 282 HOH HOH A . F 5 HOH 139 283 283 HOH HOH A . F 5 HOH 140 284 284 HOH HOH A . F 5 HOH 141 285 285 HOH HOH A . F 5 HOH 142 286 286 HOH HOH A . F 5 HOH 143 287 287 HOH HOH A . F 5 HOH 144 288 288 HOH HOH A . F 5 HOH 145 289 289 HOH HOH A . F 5 HOH 146 290 290 HOH HOH A . F 5 HOH 147 291 291 HOH HOH A . F 5 HOH 148 292 292 HOH HOH A . F 5 HOH 149 293 293 HOH HOH A . F 5 HOH 150 294 294 HOH HOH A . F 5 HOH 151 295 295 HOH HOH A . F 5 HOH 152 296 296 HOH HOH A . F 5 HOH 153 297 297 HOH HOH A . F 5 HOH 154 298 298 HOH HOH A . F 5 HOH 155 299 299 HOH HOH A . F 5 HOH 156 300 300 HOH HOH A . F 5 HOH 157 301 301 HOH HOH A . F 5 HOH 158 302 302 HOH HOH A . F 5 HOH 159 303 303 HOH HOH A . F 5 HOH 160 304 304 HOH HOH A . F 5 HOH 161 305 305 HOH HOH A . F 5 HOH 162 306 306 HOH HOH A . F 5 HOH 163 307 307 HOH HOH A . F 5 HOH 164 308 308 HOH HOH A . F 5 HOH 165 309 309 HOH HOH A . F 5 HOH 166 310 310 HOH HOH A . F 5 HOH 167 311 311 HOH HOH A . F 5 HOH 168 312 312 HOH HOH A . F 5 HOH 169 313 313 HOH HOH A . F 5 HOH 170 314 314 HOH HOH A . F 5 HOH 171 315 315 HOH HOH A . F 5 HOH 172 316 316 HOH HOH A . F 5 HOH 173 317 317 HOH HOH A . F 5 HOH 174 318 318 HOH HOH A . F 5 HOH 175 319 319 HOH HOH A . F 5 HOH 176 320 320 HOH HOH A . F 5 HOH 177 321 321 HOH HOH A . F 5 HOH 178 322 322 HOH HOH A . F 5 HOH 179 323 323 HOH HOH A . F 5 HOH 180 324 324 HOH HOH A . F 5 HOH 181 325 325 HOH HOH A . F 5 HOH 182 326 326 HOH HOH A . F 5 HOH 183 327 327 HOH HOH A . F 5 HOH 184 328 328 HOH HOH A . F 5 HOH 185 329 329 HOH HOH A . F 5 HOH 186 330 330 HOH HOH A . F 5 HOH 187 331 331 HOH HOH A . F 5 HOH 188 332 332 HOH HOH A . F 5 HOH 189 333 333 HOH HOH A . F 5 HOH 190 334 334 HOH HOH A . F 5 HOH 191 335 335 HOH HOH A . F 5 HOH 192 336 336 HOH HOH A . F 5 HOH 193 337 337 HOH HOH A . F 5 HOH 194 338 338 HOH HOH A . F 5 HOH 195 339 339 HOH HOH A . F 5 HOH 196 340 340 HOH HOH A . F 5 HOH 197 341 341 HOH HOH A . F 5 HOH 198 342 342 HOH HOH A . F 5 HOH 199 343 343 HOH HOH A . F 5 HOH 200 344 344 HOH HOH A . F 5 HOH 201 345 345 HOH HOH A . F 5 HOH 202 346 346 HOH HOH A . F 5 HOH 203 347 347 HOH HOH A . F 5 HOH 204 348 348 HOH HOH A . F 5 HOH 205 349 349 HOH HOH A . F 5 HOH 206 350 350 HOH HOH A . F 5 HOH 207 351 351 HOH HOH A . F 5 HOH 208 352 352 HOH HOH A . F 5 HOH 209 353 353 HOH HOH A . F 5 HOH 210 354 354 HOH HOH A . F 5 HOH 211 355 355 HOH HOH A . F 5 HOH 212 356 356 HOH HOH A . F 5 HOH 213 357 357 HOH HOH A . F 5 HOH 214 358 358 HOH HOH A . F 5 HOH 215 359 359 HOH HOH A . F 5 HOH 216 360 360 HOH HOH A . F 5 HOH 217 361 361 HOH HOH A . F 5 HOH 218 362 362 HOH HOH A . F 5 HOH 219 363 363 HOH HOH A . F 5 HOH 220 364 364 HOH HOH A . F 5 HOH 221 365 365 HOH HOH A . F 5 HOH 222 366 366 HOH HOH A . F 5 HOH 223 367 367 HOH HOH A . F 5 HOH 224 368 368 HOH HOH A . F 5 HOH 225 369 369 HOH HOH A . F 5 HOH 226 370 370 HOH HOH A . F 5 HOH 227 371 371 HOH HOH A . F 5 HOH 228 372 372 HOH HOH A . F 5 HOH 229 373 373 HOH HOH A . F 5 HOH 230 374 374 HOH HOH A . F 5 HOH 231 376 376 HOH HOH A . F 5 HOH 232 377 377 HOH HOH A . F 5 HOH 233 378 378 HOH HOH A . F 5 HOH 234 379 379 HOH HOH A . F 5 HOH 235 380 380 HOH HOH A . F 5 HOH 236 381 381 HOH HOH A . F 5 HOH 237 382 382 HOH HOH A . F 5 HOH 238 383 383 HOH HOH A . F 5 HOH 239 384 384 HOH HOH A . F 5 HOH 240 385 385 HOH HOH A . F 5 HOH 241 386 386 HOH HOH A . F 5 HOH 242 387 387 HOH HOH A . F 5 HOH 243 388 388 HOH HOH A . F 5 HOH 244 389 389 HOH HOH A . F 5 HOH 245 390 390 HOH HOH A . F 5 HOH 246 391 391 HOH HOH A . F 5 HOH 247 392 392 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MLPHARE phasing . ? 1 REFMAC refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _cell.entry_id 1QHQ _cell.length_a 115.739 _cell.length_b 115.739 _cell.length_c 54.549 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1QHQ _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? # _exptl.entry_id 1QHQ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.1 _exptl_crystal.density_percent_sol 60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details 'HEPES PH 7.5, 2M LI2SO4, pH 7.0' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 113 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 1' _diffrn_detector.pdbx_collection_date 1997-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.7817 1.0 2 1.3050 1.0 3 1.3779 1.0 4 1.3799 1.0 5 1.3876 1.0 6 1.5418 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 14-BM-D' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 14-BM-D _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.7817,1.3050,1.3779,1.3799,1.3876,1.5418 # _reflns.entry_id 1QHQ _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.00 _reflns.d_resolution_high 1.55 _reflns.number_obs 29884 _reflns.number_all ? _reflns.percent_possible_obs 93.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 9.3000000 _reflns.pdbx_netI_over_sigmaI 20 _reflns.B_iso_Wilson_estimate 15.0 _reflns.pdbx_redundancy 3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.55 _reflns_shell.d_res_low 1.61 _reflns_shell.percent_possible_all 98.3 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 22.5000000 _reflns_shell.meanI_over_sigI_obs 4 _reflns_shell.pdbx_redundancy 4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1QHQ _refine.ls_number_reflns_obs 28390 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 1.55 _refine.ls_percent_reflns_obs 98 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1980000 _refine.ls_R_factor_R_free 0.2330000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 3 _refine.ls_number_reflns_R_free 927 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 20.5 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1011 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 247 _refine_hist.number_atoms_total 1270 _refine_hist.d_res_high 1.55 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.017 0.020 ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.018 0.020 ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.025 0.030 ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_plane_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _database_PDB_matrix.entry_id 1QHQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1QHQ _struct.title 'AURACYANIN, A BLUE COPPER PROTEIN FROM THE GREEN THERMOPHILIC PHOTOSYNTHETIC BACTERIUM CHLOROFLEXUS AURANTIACUS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QHQ _struct_keywords.pdbx_keywords 'ELECTRON TRANSFER' _struct_keywords.text 'ELECTRON TRANSFER, CUPREDOXIN, BLUE COPPER PROTEIN, AZURIN-LIKE, THERMOPHILE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURB_CHLAU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P27197 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QHQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P27197 _struct_ref_seq.db_align_beg 96 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 235 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 140 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA tetrameric 4 3 software_defined_assembly PQS dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 4770 ? 2 MORE -129 ? 2 'SSA (A^2)' 21310 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1,2,3,4 A,B,C,D,E,F 3 1,5 A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 57.8695000000 0.0000000000 -1.0000000000 0.0000000000 100.2329142086 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 7_554 y,x,-z-2/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -36.3660000000 4 'crystal symmetry operation' 10_664 -y+1,-x+1,-z-2/3 0.5000000000 -0.8660254038 0.0000000000 57.8695000000 -0.8660254038 -0.5000000000 0.0000000000 100.2329142086 0.0000000000 0.0000000000 -1.0000000000 -36.3660000000 5 'crystal symmetry operation' 12_554 x,x-y,-z-1/3 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -18.1830000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 66 ? ASN A 78 ? ASP A 66 ASN A 78 1 ? 13 HELX_P HELX_P2 2 ALA A 80 ? ALA A 82 ? ALA A 80 ALA A 82 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 57 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 57 A CU 141 1_555 ? ? ? ? ? ? ? 2.019 ? ? metalc2 metalc ? ? A CYS 122 SG ? ? ? 1_555 B CU . CU ? ? A CYS 122 A CU 141 1_555 ? ? ? ? ? ? ? 2.195 ? ? metalc3 metalc ? ? A HIS 127 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 127 A CU 141 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc4 metalc ? ? A MET 132 SD ? ? ? 1_555 B CU . CU ? ? A MET 132 A CU 141 1_555 ? ? ? ? ? ? ? 2.843 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 CU ? B CU . ? A CU 141 ? 1_555 SG ? A CYS 122 ? A CYS 122 ? 1_555 136.9 ? 2 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 CU ? B CU . ? A CU 141 ? 1_555 ND1 ? A HIS 127 ? A HIS 127 ? 1_555 101.5 ? 3 SG ? A CYS 122 ? A CYS 122 ? 1_555 CU ? B CU . ? A CU 141 ? 1_555 ND1 ? A HIS 127 ? A HIS 127 ? 1_555 117.3 ? 4 ND1 ? A HIS 57 ? A HIS 57 ? 1_555 CU ? B CU . ? A CU 141 ? 1_555 SD ? A MET 132 ? A MET 132 ? 1_555 79.6 ? 5 SG ? A CYS 122 ? A CYS 122 ? 1_555 CU ? B CU . ? A CU 141 ? 1_555 SD ? A MET 132 ? A MET 132 ? 1_555 105.8 ? 6 ND1 ? A HIS 127 ? A HIS 127 ? 1_555 CU ? B CU . ? A CU 141 ? 1_555 SD ? A MET 132 ? A MET 132 ? 1_555 105.1 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 17 ? ARG A 22 ? GLN A 17 ARG A 22 A 2 VAL A 42 ? ASN A 49 ? VAL A 42 ASN A 49 A 3 GLU A 104 ? ARG A 111 ? GLU A 104 ARG A 111 B 1 SER A 34 ? PRO A 38 ? SER A 34 PRO A 38 B 2 LYS A 133 ? THR A 139 ? LYS A 133 THR A 139 B 3 GLY A 116 ? ILE A 121 ? GLY A 116 ILE A 121 C 1 VAL A 60 ? VAL A 62 ? VAL A 60 VAL A 62 C 2 ALA A 93 ? TRP A 96 ? ALA A 93 TRP A 96 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 17 ? O GLN A 17 N ARG A 44 ? N ARG A 44 A 2 3 O VAL A 43 ? O VAL A 43 N PHE A 110 ? N PHE A 110 B 1 2 O LEU A 35 ? O LEU A 35 N THR A 135 ? N THR A 135 B 2 3 O GLY A 134 ? O GLY A 134 N TYR A 120 ? N TYR A 120 C 1 2 O LEU A 61 ? O LEU A 61 N ALA A 95 ? N ALA A 95 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CU Author ? ? ? ? 5 'TYPE I BLUE COPPER SITE' AC1 Software A CU 141 ? 5 'BINDING SITE FOR RESIDUE CU A 141' AC2 Software A CL 142 ? 2 'BINDING SITE FOR RESIDUE CL A 142' AC3 Software A SO4 143 ? 12 'BINDING SITE FOR RESIDUE SO4 A 143' AC4 Software A SO4 144 ? 9 'BINDING SITE FOR RESIDUE SO4 A 144' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CU 5 CU B . ? CU A 141 . ? 1_555 ? 2 CU 5 HIS A 57 ? HIS A 57 . ? 1_555 ? 3 CU 5 CYS A 122 ? CYS A 122 . ? 1_555 ? 4 CU 5 HIS A 127 ? HIS A 127 . ? 1_555 ? 5 CU 5 MET A 132 ? MET A 132 . ? 1_555 ? 6 AC1 5 GLN A 56 ? GLN A 56 . ? 1_555 ? 7 AC1 5 HIS A 57 ? HIS A 57 . ? 1_555 ? 8 AC1 5 CYS A 122 ? CYS A 122 . ? 1_555 ? 9 AC1 5 HIS A 127 ? HIS A 127 . ? 1_555 ? 10 AC1 5 MET A 132 ? MET A 132 . ? 1_555 ? 11 AC2 2 HIS A 127 ? HIS A 127 . ? 12_554 ? 12 AC2 2 HIS A 127 ? HIS A 127 . ? 1_555 ? 13 AC3 12 ARG A 44 ? ARG A 44 . ? 1_555 ? 14 AC3 12 ARG A 44 ? ARG A 44 . ? 10_664 ? 15 AC3 12 ARG A 44 ? ARG A 44 . ? 7_554 ? 16 AC3 12 ARG A 44 ? ARG A 44 . ? 4_665 ? 17 AC3 12 HOH F . ? HOH A 190 . ? 1_555 ? 18 AC3 12 HOH F . ? HOH A 190 . ? 4_665 ? 19 AC3 12 HOH F . ? HOH A 190 . ? 10_664 ? 20 AC3 12 HOH F . ? HOH A 190 . ? 7_554 ? 21 AC3 12 HOH F . ? HOH A 196 . ? 10_664 ? 22 AC3 12 HOH F . ? HOH A 196 . ? 4_665 ? 23 AC3 12 HOH F . ? HOH A 196 . ? 1_555 ? 24 AC3 12 HOH F . ? HOH A 196 . ? 7_554 ? 25 AC4 9 GLY A 64 ? GLY A 64 . ? 1_555 ? 26 AC4 9 GLY A 65 ? GLY A 65 . ? 1_555 ? 27 AC4 9 ASP A 66 ? ASP A 66 . ? 1_555 ? 28 AC4 9 ASP A 67 ? ASP A 67 . ? 1_555 ? 29 AC4 9 VAL A 68 ? VAL A 68 . ? 1_555 ? 30 AC4 9 HOH F . ? HOH A 320 . ? 1_555 ? 31 AC4 9 HOH F . ? HOH A 333 . ? 1_555 ? 32 AC4 9 HOH F . ? HOH A 362 . ? 1_555 ? 33 AC4 9 HOH F . ? HOH A 365 . ? 7_555 ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CD _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 44 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 NE _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 44 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CZ _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 44 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 133.41 _pdbx_validate_rmsd_angle.angle_target_value 123.60 _pdbx_validate_rmsd_angle.angle_deviation 9.81 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.40 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 3 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -60.57 _pdbx_validate_torsion.psi 96.00 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 ALA A 2 ? ? 12.63 2 1 LEU A 83 ? ? -11.02 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CL 142 ? C CL . 2 1 A SO4 143 ? D SO4 . # _pdbx_entry_details.entry_id 1QHQ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;SO4 S 143 LIES ON A SPECIAL POSITION AND THUS HAS 0.25 OCCUPANCY CL 142 LIES ON A TWO-FOLD AXIS ; _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ALA _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ALA _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CU CU CU N N 75 CYS N N N N 76 CYS CA C N R 77 CYS C C N N 78 CYS O O N N 79 CYS CB C N N 80 CYS SG S N N 81 CYS OXT O N N 82 CYS H H N N 83 CYS H2 H N N 84 CYS HA H N N 85 CYS HB2 H N N 86 CYS HB3 H N N 87 CYS HG H N N 88 CYS HXT H N N 89 GLN N N N N 90 GLN CA C N S 91 GLN C C N N 92 GLN O O N N 93 GLN CB C N N 94 GLN CG C N N 95 GLN CD C N N 96 GLN OE1 O N N 97 GLN NE2 N N N 98 GLN OXT O N N 99 GLN H H N N 100 GLN H2 H N N 101 GLN HA H N N 102 GLN HB2 H N N 103 GLN HB3 H N N 104 GLN HG2 H N N 105 GLN HG3 H N N 106 GLN HE21 H N N 107 GLN HE22 H N N 108 GLN HXT H N N 109 GLU N N N N 110 GLU CA C N S 111 GLU C C N N 112 GLU O O N N 113 GLU CB C N N 114 GLU CG C N N 115 GLU CD C N N 116 GLU OE1 O N N 117 GLU OE2 O N N 118 GLU OXT O N N 119 GLU H H N N 120 GLU H2 H N N 121 GLU HA H N N 122 GLU HB2 H N N 123 GLU HB3 H N N 124 GLU HG2 H N N 125 GLU HG3 H N N 126 GLU HE2 H N N 127 GLU HXT H N N 128 GLY N N N N 129 GLY CA C N N 130 GLY C C N N 131 GLY O O N N 132 GLY OXT O N N 133 GLY H H N N 134 GLY H2 H N N 135 GLY HA2 H N N 136 GLY HA3 H N N 137 GLY HXT H N N 138 HIS N N N N 139 HIS CA C N S 140 HIS C C N N 141 HIS O O N N 142 HIS CB C N N 143 HIS CG C Y N 144 HIS ND1 N Y N 145 HIS CD2 C Y N 146 HIS CE1 C Y N 147 HIS NE2 N Y N 148 HIS OXT O N N 149 HIS H H N N 150 HIS H2 H N N 151 HIS HA H N N 152 HIS HB2 H N N 153 HIS HB3 H N N 154 HIS HD1 H N N 155 HIS HD2 H N N 156 HIS HE1 H N N 157 HIS HE2 H N N 158 HIS HXT H N N 159 HOH O O N N 160 HOH H1 H N N 161 HOH H2 H N N 162 ILE N N N N 163 ILE CA C N S 164 ILE C C N N 165 ILE O O N N 166 ILE CB C N S 167 ILE CG1 C N N 168 ILE CG2 C N N 169 ILE CD1 C N N 170 ILE OXT O N N 171 ILE H H N N 172 ILE H2 H N N 173 ILE HA H N N 174 ILE HB H N N 175 ILE HG12 H N N 176 ILE HG13 H N N 177 ILE HG21 H N N 178 ILE HG22 H N N 179 ILE HG23 H N N 180 ILE HD11 H N N 181 ILE HD12 H N N 182 ILE HD13 H N N 183 ILE HXT H N N 184 LEU N N N N 185 LEU CA C N S 186 LEU C C N N 187 LEU O O N N 188 LEU CB C N N 189 LEU CG C N N 190 LEU CD1 C N N 191 LEU CD2 C N N 192 LEU OXT O N N 193 LEU H H N N 194 LEU H2 H N N 195 LEU HA H N N 196 LEU HB2 H N N 197 LEU HB3 H N N 198 LEU HG H N N 199 LEU HD11 H N N 200 LEU HD12 H N N 201 LEU HD13 H N N 202 LEU HD21 H N N 203 LEU HD22 H N N 204 LEU HD23 H N N 205 LEU HXT H N N 206 LYS N N N N 207 LYS CA C N S 208 LYS C C N N 209 LYS O O N N 210 LYS CB C N N 211 LYS CG C N N 212 LYS CD C N N 213 LYS CE C N N 214 LYS NZ N N N 215 LYS OXT O N N 216 LYS H H N N 217 LYS H2 H N N 218 LYS HA H N N 219 LYS HB2 H N N 220 LYS HB3 H N N 221 LYS HG2 H N N 222 LYS HG3 H N N 223 LYS HD2 H N N 224 LYS HD3 H N N 225 LYS HE2 H N N 226 LYS HE3 H N N 227 LYS HZ1 H N N 228 LYS HZ2 H N N 229 LYS HZ3 H N N 230 LYS HXT H N N 231 MET N N N N 232 MET CA C N S 233 MET C C N N 234 MET O O N N 235 MET CB C N N 236 MET CG C N N 237 MET SD S N N 238 MET CE C N N 239 MET OXT O N N 240 MET H H N N 241 MET H2 H N N 242 MET HA H N N 243 MET HB2 H N N 244 MET HB3 H N N 245 MET HG2 H N N 246 MET HG3 H N N 247 MET HE1 H N N 248 MET HE2 H N N 249 MET HE3 H N N 250 MET HXT H N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 SO4 S S N N 306 SO4 O1 O N N 307 SO4 O2 O N N 308 SO4 O3 O N N 309 SO4 O4 O N N 310 THR N N N N 311 THR CA C N S 312 THR C C N N 313 THR O O N N 314 THR CB C N R 315 THR OG1 O N N 316 THR CG2 C N N 317 THR OXT O N N 318 THR H H N N 319 THR H2 H N N 320 THR HA H N N 321 THR HB H N N 322 THR HG1 H N N 323 THR HG21 H N N 324 THR HG22 H N N 325 THR HG23 H N N 326 THR HXT H N N 327 TRP N N N N 328 TRP CA C N S 329 TRP C C N N 330 TRP O O N N 331 TRP CB C N N 332 TRP CG C Y N 333 TRP CD1 C Y N 334 TRP CD2 C Y N 335 TRP NE1 N Y N 336 TRP CE2 C Y N 337 TRP CE3 C Y N 338 TRP CZ2 C Y N 339 TRP CZ3 C Y N 340 TRP CH2 C Y N 341 TRP OXT O N N 342 TRP H H N N 343 TRP H2 H N N 344 TRP HA H N N 345 TRP HB2 H N N 346 TRP HB3 H N N 347 TRP HD1 H N N 348 TRP HE1 H N N 349 TRP HE3 H N N 350 TRP HZ2 H N N 351 TRP HZ3 H N N 352 TRP HH2 H N N 353 TRP HXT H N N 354 TYR N N N N 355 TYR CA C N S 356 TYR C C N N 357 TYR O O N N 358 TYR CB C N N 359 TYR CG C Y N 360 TYR CD1 C Y N 361 TYR CD2 C Y N 362 TYR CE1 C Y N 363 TYR CE2 C Y N 364 TYR CZ C Y N 365 TYR OH O N N 366 TYR OXT O N N 367 TYR H H N N 368 TYR H2 H N N 369 TYR HA H N N 370 TYR HB2 H N N 371 TYR HB3 H N N 372 TYR HD1 H N N 373 TYR HD2 H N N 374 TYR HE1 H N N 375 TYR HE2 H N N 376 TYR HH H N N 377 TYR HXT H N N 378 VAL N N N N 379 VAL CA C N S 380 VAL C C N N 381 VAL O O N N 382 VAL CB C N N 383 VAL CG1 C N N 384 VAL CG2 C N N 385 VAL OXT O N N 386 VAL H H N N 387 VAL H2 H N N 388 VAL HA H N N 389 VAL HB H N N 390 VAL HG11 H N N 391 VAL HG12 H N N 392 VAL HG13 H N N 393 VAL HG21 H N N 394 VAL HG22 H N N 395 VAL HG23 H N N 396 VAL HXT H N N 397 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _atom_sites.entry_id 1QHQ _atom_sites.fract_transf_matrix[1][1] 0.008640 _atom_sites.fract_transf_matrix[1][2] 0.004988 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009977 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018332 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL CU N O S # loop_