data_1QLD # _entry.id 1QLD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.299 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1QLD PDBE EBI-4049 WWPDB D_1290004049 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1CT7 unspecified 'THE NMR ENSEMBLE STRUCTURES FOR THIS ENTRY (1QLD)' PDB 1CLX unspecified 'CATALYTIC CORE OF XYLANASE A, RESIDUES 264 - 611' PDB 1XYS unspecified 'CATALYTIC CORE OF XYLANASE A E246C MUTANT' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QLD _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 1999-08-26 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Raghothama, S.' 1 'Simpson, P.J.' 2 'Gilbert, H.J.' 3 'Williamson, M.P.' 4 # _citation.id primary _citation.title 'Solution Structure of Cbm10 Cellulose Binding Module from Pseudomonas Xylanase A' _citation.journal_abbrev Biochemistry _citation.journal_volume 39 _citation.page_first 978 _citation.page_last ? _citation.year 2000 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10653641 _citation.pdbx_database_id_DOI 10.1021/BI992163+ # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Raghothama, S.' 1 ? primary 'Simpson, P.J.' 2 ? primary 'Szabo, L.' 3 ? primary 'Nagy, T.' 4 ? primary 'Gilbert, H.J.' 5 ? primary 'Williamson, M.P.' 6 ? # _cell.entry_id 1QLD _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QLD _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description XYLANASE _entity.formula_weight 5400.007 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.8 _entity.pdbx_mutation ? _entity.pdbx_fragment 'CELLULOSE BINDING DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ENDO-1,4-BETA-XYLANASE A, XYLANASE A, 1,4-BETA-D-XYLAN XYLANOHYDROLASE A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGNQQCNWYGTLYPLCVTTTNGWGWEDQRSCIARSTCAAQPAPFGIVGSG _entity_poly.pdbx_seq_one_letter_code_can MGNQQCNWYGTLYPLCVTTTNGWGWEDQRSCIARSTCAAQPAPFGIVGSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASN n 1 4 GLN n 1 5 GLN n 1 6 CYS n 1 7 ASN n 1 8 TRP n 1 9 TYR n 1 10 GLY n 1 11 THR n 1 12 LEU n 1 13 TYR n 1 14 PRO n 1 15 LEU n 1 16 CYS n 1 17 VAL n 1 18 THR n 1 19 THR n 1 20 THR n 1 21 ASN n 1 22 GLY n 1 23 TRP n 1 24 GLY n 1 25 TRP n 1 26 GLU n 1 27 ASP n 1 28 GLN n 1 29 ARG n 1 30 SER n 1 31 CYS n 1 32 ILE n 1 33 ALA n 1 34 ARG n 1 35 SER n 1 36 THR n 1 37 CYS n 1 38 ALA n 1 39 ALA n 1 40 GLN n 1 41 PRO n 1 42 ALA n 1 43 PRO n 1 44 PHE n 1 45 GLY n 1 46 ILE n 1 47 VAL n 1 48 GLY n 1 49 SER n 1 50 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'PSEUDOMONAS FLUORESCENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 294 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'PSEUDOMONAS FLUORESCENS CELLULOSA' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code XYNA_PSEFL _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P14768 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QLD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P14768 _struct_ref_seq.db_align_beg 180 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 228 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 69 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1QLD _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P14768 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 20 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 TOCSY 1 2 1 NOESY 1 3 1 DQF-COSY 1 4 1 E.COSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 MM NACL' _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER / 10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 DRX Bruker 500 2 DRX Bruker 600 # _pdbx_nmr_refine.entry_id 1QLD _pdbx_nmr_refine.method 'DISTANCE GEOMETRY, SIMULATED ANNEALING' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1QLD _pdbx_nmr_details.text ;MINIMIZED AVERAGE STRUCTURE. THE STRUCTURE WAS DETERMINED USING STANDARD 2D HOMONUCLEAR TECHNIQUES. FOR THE ATOM RECORDS THE VALUE GIVEN IN THE TEMPERATURE FACTOR COLUMN IS THE RMSD PER ATOM TO THE MEAN POSITION. ; # _pdbx_nmr_ensemble.entry_id 1QLD _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'AN AVERAGE STRUCTURE OF 21 LOWEST ENERGY STRUCTURES WAS CALCULATED, WHICH WAS FURTHER SUBJECTED TO RESTRAINED ENERGY MINIMIZATION.' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' FELIX ? ? 2 # _exptl.entry_id 1QLD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1QLD _struct.title 'Solution structure of type X CBM' _struct.pdbx_descriptor 'XYLANASE (E.C.3.2.1.8)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'MINIMIZED AVERAGE' # _struct_keywords.entry_id 1QLD _struct_keywords.pdbx_keywords XYLANASE _struct_keywords.text 'XYLANASE, BETA STRANDS, ANTI PARALLEL BETA SHEETS, XYLAN DEGRADATION, HYDROLASE, GLYCOSIDASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 33 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 38 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 52 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 57 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 25 A CYS 56 1_555 ? ? ? ? ? ? ? 2.010 ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 35 A CYS 50 1_555 ? ? ? ? ? ? ? 2.020 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 42 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 61 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 43 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 62 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.08 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 5 ? TRP A 8 ? GLN A 24 TRP A 27 A 2 THR A 11 ? PRO A 14 ? THR A 30 PRO A 33 B 1 TRP A 23 ? GLU A 26 ? TRP A 42 GLU A 45 B 2 ARG A 29 ? ILE A 32 ? ARG A 48 ILE A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 6 ? O CYS A 25 N TYR A 13 ? N TYR A 32 B 1 2 O GLY A 24 ? O GLY A 43 N CYS A 31 ? N CYS A 50 # _database_PDB_matrix.entry_id 1QLD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QLD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 20 20 MET MET A . n A 1 2 GLY 2 21 21 GLY GLY A . n A 1 3 ASN 3 22 22 ASN ASN A . n A 1 4 GLN 4 23 23 GLN GLN A . n A 1 5 GLN 5 24 24 GLN GLN A . n A 1 6 CYS 6 25 25 CYS CYS A . n A 1 7 ASN 7 26 26 ASN ASN A . n A 1 8 TRP 8 27 27 TRP TRP A . n A 1 9 TYR 9 28 28 TYR TYR A . n A 1 10 GLY 10 29 29 GLY GLY A . n A 1 11 THR 11 30 30 THR THR A . n A 1 12 LEU 12 31 31 LEU LEU A . n A 1 13 TYR 13 32 32 TYR TYR A . n A 1 14 PRO 14 33 33 PRO PRO A . n A 1 15 LEU 15 34 34 LEU LEU A . n A 1 16 CYS 16 35 35 CYS CYS A . n A 1 17 VAL 17 36 36 VAL VAL A . n A 1 18 THR 18 37 37 THR THR A . n A 1 19 THR 19 38 38 THR THR A . n A 1 20 THR 20 39 39 THR THR A . n A 1 21 ASN 21 40 40 ASN ASN A . n A 1 22 GLY 22 41 41 GLY GLY A . n A 1 23 TRP 23 42 42 TRP TRP A . n A 1 24 GLY 24 43 43 GLY GLY A . n A 1 25 TRP 25 44 44 TRP TRP A . n A 1 26 GLU 26 45 45 GLU GLU A . n A 1 27 ASP 27 46 46 ASP ASP A . n A 1 28 GLN 28 47 47 GLN GLN A . n A 1 29 ARG 29 48 48 ARG ARG A . n A 1 30 SER 30 49 49 SER SER A . n A 1 31 CYS 31 50 50 CYS CYS A . n A 1 32 ILE 32 51 51 ILE ILE A . n A 1 33 ALA 33 52 52 ALA ALA A . n A 1 34 ARG 34 53 53 ARG ARG A . n A 1 35 SER 35 54 54 SER SER A . n A 1 36 THR 36 55 55 THR THR A . n A 1 37 CYS 37 56 56 CYS CYS A . n A 1 38 ALA 38 57 57 ALA ALA A . n A 1 39 ALA 39 58 58 ALA ALA A . n A 1 40 GLN 40 59 59 GLN GLN A . n A 1 41 PRO 41 60 60 PRO PRO A . n A 1 42 ALA 42 61 61 ALA ALA A . n A 1 43 PRO 43 62 62 PRO PRO A . n A 1 44 PHE 44 63 63 PHE PHE A . n A 1 45 GLY 45 64 64 GLY GLY A . n A 1 46 ILE 46 65 65 ILE ILE A . n A 1 47 VAL 47 66 66 VAL VAL A . n A 1 48 GLY 48 67 67 GLY GLY A . n A 1 49 SER 49 68 68 SER SER A . n A 1 50 GLY 50 69 69 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-02-06 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-10-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Source and taxonomy' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category entity_src_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity_src_gen.gene_src_strain' 2 4 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 3 4 'Structure model' '_entity_src_gen.pdbx_host_org_strain' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE3 A TRP 44 ? ? HA A SER 49 ? ? 0.72 2 1 CE3 A TRP 44 ? ? HA A SER 49 ? ? 1.31 3 1 CZ3 A TRP 44 ? ? N A SER 49 ? ? 1.37 4 1 HZ3 A TRP 44 ? ? N A SER 49 ? ? 1.45 5 1 HZ3 A TRP 44 ? ? OG A SER 49 ? ? 1.48 6 1 HZ3 A TRP 44 ? ? CB A SER 49 ? ? 1.57 7 1 CE3 A TRP 44 ? ? CA A SER 49 ? ? 1.88 8 1 CZ3 A TRP 44 ? ? C A ARG 48 ? ? 1.90 9 1 CZ3 A TRP 44 ? ? CA A SER 49 ? ? 1.93 10 1 CD2 A TRP 44 ? ? O A ARG 48 ? ? 1.97 11 1 CH2 A TRP 44 ? ? C A ARG 48 ? ? 2.06 12 1 CE3 A TRP 44 ? ? O A ARG 48 ? ? 2.06 13 1 CE3 A TRP 44 ? ? N A SER 49 ? ? 2.08 14 1 CH2 A TRP 44 ? ? N A SER 49 ? ? 2.15 15 1 CH2 A TRP 44 ? ? CA A ARG 48 ? ? 2.18 16 1 CE3 A TRP 44 ? ? C A ARG 48 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 26 ? ? -59.10 88.06 2 1 TYR A 28 ? ? 31.81 28.47 3 1 THR A 39 ? ? -58.28 -9.39 4 1 ASN A 40 ? ? -87.12 36.52 5 1 ALA A 52 ? ? -40.87 172.42 6 1 ARG A 53 ? ? -57.48 -82.45 7 1 CYS A 56 ? ? -72.21 -76.24 8 1 ALA A 58 ? ? -29.19 -35.03 9 1 GLN A 59 ? ? -43.01 161.91 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 48 ? ? 0.309 'SIDE CHAIN' 2 1 ARG A 53 ? ? 0.304 'SIDE CHAIN' #