data_1QLK # _entry.id 1QLK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1QLK pdb_00001qlk 10.2210/pdb1qlk/pdb WWPDB D_1000175919 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-11-11 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.value' 22 4 'Structure model' '_struct_conn.pdbx_dist_value' 23 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 24 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 30 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 31 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 32 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 35 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 36 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 37 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 38 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 39 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QLK _pdbx_database_status.recvd_initial_deposition_date 1997-09-26 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Drohat, A.C.' 1 'Baldisseri, D.M.' 2 'Rustandi, R.R.' 3 'Weber, D.J.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of calcium-bound rat S100B(betabeta) as determined by nuclear magnetic resonance spectroscopy,.' Biochemistry 37 2729 2740 1998 BICHAW US 0006-2960 0033 ? 9485423 10.1021/bi972635p 1 'Solution Structure of Rat Apo-S100B(Beta Beta) as Determined by NMR Spectroscopy' Biochemistry 35 11577 ? 1996 BICHAW US 0006-2960 0033 ? ? ? 2 '1H, 13C and 15N NMR Assignments and Solution Secondary Structure of Rat Apo-S100 Beta' J.Biomol.NMR 6 171 ? 1995 JBNME9 NE 0925-2738 0800 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Drohat, A.C.' 1 ? primary 'Baldisseri, D.M.' 2 ? primary 'Rustandi, R.R.' 3 ? primary 'Weber, D.J.' 4 ? 1 'Drohat, A.C.' 5 ? 1 'Amburgey, J.C.' 6 ? 1 'Abildgaard, F.' 7 ? 1 'Starich, M.R.' 8 ? 1 'Baldisseri, D.' 9 ? 1 'Weber, D.J.' 10 ? 2 'Amburgey, J.C.' 11 ? 2 'Abildgaard, F.' 12 ? 2 'Starich, M.R.' 13 ? 2 'Shah, S.' 14 ? 2 'Hilt, D.C.' 15 ? 2 'Weber, D.J.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'S-100 PROTEIN' 10758.048 2 ? ? 'SUBUNITS A AND B' ? 2 non-polymer syn 'CALCIUM ION' 40.078 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSM VTTACHEFFEHE ; _entity_poly.pdbx_seq_one_letter_code_can ;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSM VTTACHEFFEHE ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 LEU n 1 5 GLU n 1 6 LYS n 1 7 ALA n 1 8 MET n 1 9 VAL n 1 10 ALA n 1 11 LEU n 1 12 ILE n 1 13 ASP n 1 14 VAL n 1 15 PHE n 1 16 HIS n 1 17 GLN n 1 18 TYR n 1 19 SER n 1 20 GLY n 1 21 ARG n 1 22 GLU n 1 23 GLY n 1 24 ASP n 1 25 LYS n 1 26 HIS n 1 27 LYS n 1 28 LEU n 1 29 LYS n 1 30 LYS n 1 31 SER n 1 32 GLU n 1 33 LEU n 1 34 LYS n 1 35 GLU n 1 36 LEU n 1 37 ILE n 1 38 ASN n 1 39 ASN n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 HIS n 1 44 PHE n 1 45 LEU n 1 46 GLU n 1 47 GLU n 1 48 ILE n 1 49 LYS n 1 50 GLU n 1 51 GLN n 1 52 GLU n 1 53 VAL n 1 54 VAL n 1 55 ASP n 1 56 LYS n 1 57 VAL n 1 58 MET n 1 59 GLU n 1 60 THR n 1 61 LEU n 1 62 ASP n 1 63 GLU n 1 64 ASP n 1 65 GLY n 1 66 ASP n 1 67 GLY n 1 68 GLU n 1 69 CYS n 1 70 ASP n 1 71 PHE n 1 72 GLN n 1 73 GLU n 1 74 PHE n 1 75 MET n 1 76 ALA n 1 77 PHE n 1 78 VAL n 1 79 SER n 1 80 MET n 1 81 VAL n 1 82 THR n 1 83 THR n 1 84 ALA n 1 85 CYS n 1 86 HIS n 1 87 GLU n 1 88 PHE n 1 89 PHE n 1 90 GLU n 1 91 HIS n 1 92 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene S100BETA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'HMS174 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET11B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 GLU 3 2 2 GLU GLU A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 ALA 7 6 6 ALA ALA A . n A 1 8 MET 8 7 7 MET MET A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ALA 10 9 9 ALA ALA A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 ASP 13 12 12 ASP ASP A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 PHE 15 14 14 PHE PHE A . n A 1 16 HIS 16 15 15 HIS HIS A . n A 1 17 GLN 17 16 16 GLN GLN A . n A 1 18 TYR 18 17 17 TYR TYR A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 GLY 20 19 19 GLY GLY A . n A 1 21 ARG 21 20 20 ARG ARG A . n A 1 22 GLU 22 21 21 GLU GLU A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 ASP 24 23 23 ASP ASP A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 HIS 26 25 25 HIS HIS A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 LYS 34 33 33 LYS LYS A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 ASN 38 37 37 ASN ASN A . n A 1 39 ASN 39 38 38 ASN ASN A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 HIS 43 42 42 HIS HIS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 GLU 46 45 45 GLU GLU A . n A 1 47 GLU 47 46 46 GLU GLU A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 GLN 51 50 50 GLN GLN A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 VAL 54 53 53 VAL VAL A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 VAL 57 56 56 VAL VAL A . n A 1 58 MET 58 57 57 MET MET A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 ASP 64 63 63 ASP ASP A . n A 1 65 GLY 65 64 64 GLY GLY A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 GLY 67 66 66 GLY GLY A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 CYS 69 68 68 CYS CYS A . n A 1 70 ASP 70 69 69 ASP ASP A . n A 1 71 PHE 71 70 70 PHE PHE A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 GLU 73 72 72 GLU GLU A . n A 1 74 PHE 74 73 73 PHE PHE A . n A 1 75 MET 75 74 74 MET MET A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 PHE 77 76 76 PHE PHE A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 SER 79 78 78 SER SER A . n A 1 80 MET 80 79 79 MET MET A . n A 1 81 VAL 81 80 80 VAL VAL A . n A 1 82 THR 82 81 81 THR THR A . n A 1 83 THR 83 82 82 THR THR A . n A 1 84 ALA 84 83 83 ALA ALA A . n A 1 85 CYS 85 84 84 CYS CYS A . n A 1 86 HIS 86 85 85 HIS HIS A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 PHE 88 87 87 PHE PHE A . n A 1 89 PHE 89 88 88 PHE PHE A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 HIS 91 90 90 HIS HIS A . n A 1 92 GLU 92 91 91 GLU GLU A . n B 1 1 MET 1 0 0 MET MET B . n B 1 2 SER 2 1 1 SER SER B . n B 1 3 GLU 3 2 2 GLU GLU B . n B 1 4 LEU 4 3 3 LEU LEU B . n B 1 5 GLU 5 4 4 GLU GLU B . n B 1 6 LYS 6 5 5 LYS LYS B . n B 1 7 ALA 7 6 6 ALA ALA B . n B 1 8 MET 8 7 7 MET MET B . n B 1 9 VAL 9 8 8 VAL VAL B . n B 1 10 ALA 10 9 9 ALA ALA B . n B 1 11 LEU 11 10 10 LEU LEU B . n B 1 12 ILE 12 11 11 ILE ILE B . n B 1 13 ASP 13 12 12 ASP ASP B . n B 1 14 VAL 14 13 13 VAL VAL B . n B 1 15 PHE 15 14 14 PHE PHE B . n B 1 16 HIS 16 15 15 HIS HIS B . n B 1 17 GLN 17 16 16 GLN GLN B . n B 1 18 TYR 18 17 17 TYR TYR B . n B 1 19 SER 19 18 18 SER SER B . n B 1 20 GLY 20 19 19 GLY GLY B . n B 1 21 ARG 21 20 20 ARG ARG B . n B 1 22 GLU 22 21 21 GLU GLU B . n B 1 23 GLY 23 22 22 GLY GLY B . n B 1 24 ASP 24 23 23 ASP ASP B . n B 1 25 LYS 25 24 24 LYS LYS B . n B 1 26 HIS 26 25 25 HIS HIS B . n B 1 27 LYS 27 26 26 LYS LYS B . n B 1 28 LEU 28 27 27 LEU LEU B . n B 1 29 LYS 29 28 28 LYS LYS B . n B 1 30 LYS 30 29 29 LYS LYS B . n B 1 31 SER 31 30 30 SER SER B . n B 1 32 GLU 32 31 31 GLU GLU B . n B 1 33 LEU 33 32 32 LEU LEU B . n B 1 34 LYS 34 33 33 LYS LYS B . n B 1 35 GLU 35 34 34 GLU GLU B . n B 1 36 LEU 36 35 35 LEU LEU B . n B 1 37 ILE 37 36 36 ILE ILE B . n B 1 38 ASN 38 37 37 ASN ASN B . n B 1 39 ASN 39 38 38 ASN ASN B . n B 1 40 GLU 40 39 39 GLU GLU B . n B 1 41 LEU 41 40 40 LEU LEU B . n B 1 42 SER 42 41 41 SER SER B . n B 1 43 HIS 43 42 42 HIS HIS B . n B 1 44 PHE 44 43 43 PHE PHE B . n B 1 45 LEU 45 44 44 LEU LEU B . n B 1 46 GLU 46 45 45 GLU GLU B . n B 1 47 GLU 47 46 46 GLU GLU B . n B 1 48 ILE 48 47 47 ILE ILE B . n B 1 49 LYS 49 48 48 LYS LYS B . n B 1 50 GLU 50 49 49 GLU GLU B . n B 1 51 GLN 51 50 50 GLN GLN B . n B 1 52 GLU 52 51 51 GLU GLU B . n B 1 53 VAL 53 52 52 VAL VAL B . n B 1 54 VAL 54 53 53 VAL VAL B . n B 1 55 ASP 55 54 54 ASP ASP B . n B 1 56 LYS 56 55 55 LYS LYS B . n B 1 57 VAL 57 56 56 VAL VAL B . n B 1 58 MET 58 57 57 MET MET B . n B 1 59 GLU 59 58 58 GLU GLU B . n B 1 60 THR 60 59 59 THR THR B . n B 1 61 LEU 61 60 60 LEU LEU B . n B 1 62 ASP 62 61 61 ASP ASP B . n B 1 63 GLU 63 62 62 GLU GLU B . n B 1 64 ASP 64 63 63 ASP ASP B . n B 1 65 GLY 65 64 64 GLY GLY B . n B 1 66 ASP 66 65 65 ASP ASP B . n B 1 67 GLY 67 66 66 GLY GLY B . n B 1 68 GLU 68 67 67 GLU GLU B . n B 1 69 CYS 69 68 68 CYS CYS B . n B 1 70 ASP 70 69 69 ASP ASP B . n B 1 71 PHE 71 70 70 PHE PHE B . n B 1 72 GLN 72 71 71 GLN GLN B . n B 1 73 GLU 73 72 72 GLU GLU B . n B 1 74 PHE 74 73 73 PHE PHE B . n B 1 75 MET 75 74 74 MET MET B . n B 1 76 ALA 76 75 75 ALA ALA B . n B 1 77 PHE 77 76 76 PHE PHE B . n B 1 78 VAL 78 77 77 VAL VAL B . n B 1 79 SER 79 78 78 SER SER B . n B 1 80 MET 80 79 79 MET MET B . n B 1 81 VAL 81 80 80 VAL VAL B . n B 1 82 THR 82 81 81 THR THR B . n B 1 83 THR 83 82 82 THR THR B . n B 1 84 ALA 84 83 83 ALA ALA B . n B 1 85 CYS 85 84 84 CYS CYS B . n B 1 86 HIS 86 85 85 HIS HIS B . n B 1 87 GLU 87 86 86 GLU GLU B . n B 1 88 PHE 88 87 87 PHE PHE B . n B 1 89 PHE 89 88 88 PHE PHE B . n B 1 90 GLU 90 89 89 GLU GLU B . n B 1 91 HIS 91 90 90 HIS HIS B . n B 1 92 GLU 92 91 91 GLU GLU B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CA 1 92 92 CA CA A . D 2 CA 1 93 93 CA CA A . E 2 CA 1 92 92 CA CA B . F 2 CA 1 93 93 CA CA B . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.851 ? 1 X-PLOR refinement 3.851 ? 2 X-PLOR phasing 3.851 ? 3 # _cell.entry_id 1QLK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QLK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1QLK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1QLK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1QLK _struct.title 'SOLUTION STRUCTURE OF CA(2+)-LOADED RAT S100B (BETABETA) NMR, 20 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QLK _struct_keywords.pdbx_keywords CALCIUM-BINDING _struct_keywords.text 'S100BETA, S100B, EF-HAND, S100 PROTEIN, CALCIUM-BINDING PROTEIN, FOUR-HELIX BUNDLE, CALCIUM-BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S100B_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04631 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMV TTACHEFFEHE ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1QLK A 2 ? 92 ? P04631 1 ? 91 ? 1 91 2 1 1QLK B 2 ? 92 ? P04631 1 ? 91 ? 1 91 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 3 ? ARG A 21 ? GLU A 2 ARG A 20 1 ? 19 HELX_P HELX_P2 2 LYS A 30 ? HIS A 43 ? LYS A 29 HIS A 42 1 ? 14 HELX_P HELX_P3 3 GLN A 51 ? LEU A 61 ? GLN A 50 LEU A 60 1 ? 11 HELX_P HELX_P4 4 PHE A 71 ? ALA A 84 ? PHE A 70 ALA A 83 1 ? 14 HELX_P HELX_P5 5 GLU B 3 ? ARG B 21 ? GLU B 2 ARG B 20 1 ? 19 HELX_P HELX_P6 6 LYS B 30 ? HIS B 43 ? LYS B 29 HIS B 42 1 ? 14 HELX_P HELX_P7 7 GLN B 51 ? LEU B 61 ? GLN B 50 LEU B 60 1 ? 11 HELX_P HELX_P8 8 PHE B 71 ? ALA B 84 ? PHE B 70 ALA B 83 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 19 O ? ? ? 1_555 C CA . CA ? ? A SER 18 A CA 92 1_555 ? ? ? ? ? ? ? 2.972 ? ? metalc2 metalc ? ? A ASP 24 O ? ? ? 1_555 C CA . CA ? ? A ASP 23 A CA 92 1_555 ? ? ? ? ? ? ? 2.734 ? ? metalc3 metalc ? ? A LYS 27 O ? ? ? 1_555 C CA . CA ? ? A LYS 26 A CA 92 1_555 ? ? ? ? ? ? ? 2.900 ? ? metalc4 metalc ? ? A GLU 32 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 31 A CA 92 1_555 ? ? ? ? ? ? ? 2.608 ? ? metalc5 metalc ? ? A ASP 64 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 63 A CA 93 1_555 ? ? ? ? ? ? ? 2.975 ? ? metalc6 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 65 A CA 93 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc7 metalc ? ? A GLU 68 O ? ? ? 1_555 D CA . CA ? ? A GLU 67 A CA 93 1_555 ? ? ? ? ? ? ? 2.923 ? ? metalc8 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 72 A CA 93 1_555 ? ? ? ? ? ? ? 2.073 ? ? metalc9 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 72 A CA 93 1_555 ? ? ? ? ? ? ? 2.455 ? ? metalc10 metalc ? ? B SER 19 O ? ? ? 1_555 E CA . CA ? ? B SER 18 B CA 92 1_555 ? ? ? ? ? ? ? 2.899 ? ? metalc11 metalc ? ? B ASP 24 O ? ? ? 1_555 E CA . CA ? ? B ASP 23 B CA 92 1_555 ? ? ? ? ? ? ? 2.522 ? ? metalc12 metalc ? ? B LYS 27 O ? ? ? 1_555 E CA . CA ? ? B LYS 26 B CA 92 1_555 ? ? ? ? ? ? ? 2.745 ? ? metalc13 metalc ? ? B GLU 32 OE1 ? ? ? 1_555 E CA . CA ? ? B GLU 31 B CA 92 1_555 ? ? ? ? ? ? ? 2.910 ? ? metalc14 metalc ? ? B ASP 64 OD1 ? ? ? 1_555 F CA . CA ? ? B ASP 63 B CA 93 1_555 ? ? ? ? ? ? ? 2.902 ? ? metalc15 metalc ? ? B ASP 66 OD1 ? ? ? 1_555 F CA . CA ? ? B ASP 65 B CA 93 1_555 ? ? ? ? ? ? ? 2.078 ? ? metalc16 metalc ? ? B GLU 68 O ? ? ? 1_555 F CA . CA ? ? B GLU 67 B CA 93 1_555 ? ? ? ? ? ? ? 2.888 ? ? metalc17 metalc ? ? B GLU 73 OE2 ? ? ? 1_555 F CA . CA ? ? B GLU 72 B CA 93 1_555 ? ? ? ? ? ? ? 2.156 ? ? metalc18 metalc ? ? B GLU 73 OE1 ? ? ? 1_555 F CA . CA ? ? B GLU 72 B CA 93 1_555 ? ? ? ? ? ? ? 2.656 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O ? A ASP 24 ? A ASP 23 ? 1_555 57.3 ? 2 O ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 133.4 ? 3 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 83.8 ? 4 O ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 115.0 ? 5 O ? A ASP 24 ? A ASP 23 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 161.0 ? 6 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 109.6 ? 7 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 81.4 ? 8 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 120.3 ? 9 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 53.3 ? 10 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 68.1 ? 11 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 98.5 ? 12 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 81.3 ? 13 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 118.9 ? 14 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 126.5 ? 15 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 75.3 ? 16 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 56.0 ? 17 O ? B SER 19 ? B SER 18 ? 1_555 CA ? E CA . ? B CA 92 ? 1_555 O ? B ASP 24 ? B ASP 23 ? 1_555 60.2 ? 18 O ? B SER 19 ? B SER 18 ? 1_555 CA ? E CA . ? B CA 92 ? 1_555 O ? B LYS 27 ? B LYS 26 ? 1_555 145.3 ? 19 O ? B ASP 24 ? B ASP 23 ? 1_555 CA ? E CA . ? B CA 92 ? 1_555 O ? B LYS 27 ? B LYS 26 ? 1_555 91.2 ? 20 O ? B SER 19 ? B SER 18 ? 1_555 CA ? E CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31 ? 1_555 108.3 ? 21 O ? B ASP 24 ? B ASP 23 ? 1_555 CA ? E CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31 ? 1_555 152.2 ? 22 O ? B LYS 27 ? B LYS 26 ? 1_555 CA ? E CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31 ? 1_555 105.8 ? 23 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? F CA . ? B CA 93 ? 1_555 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 86.5 ? 24 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? F CA . ? B CA 93 ? 1_555 O ? B GLU 68 ? B GLU 67 ? 1_555 124.3 ? 25 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? F CA . ? B CA 93 ? 1_555 O ? B GLU 68 ? B GLU 67 ? 1_555 54.9 ? 26 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? F CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 68.7 ? 27 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? F CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 101.9 ? 28 O ? B GLU 68 ? B GLU 67 ? 1_555 CA ? F CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 80.9 ? 29 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? F CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 115.1 ? 30 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? F CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 125.8 ? 31 O ? B GLU 68 ? B GLU 67 ? 1_555 CA ? F CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 73.0 ? 32 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 CA ? F CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 51.9 ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 92 ? 5 'BINDING SITE FOR RESIDUE CA A 92' AC2 Software A CA 93 ? 4 'BINDING SITE FOR RESIDUE CA A 93' AC3 Software B CA 92 ? 5 'BINDING SITE FOR RESIDUE CA B 92' AC4 Software B CA 93 ? 6 'BINDING SITE FOR RESIDUE CA B 93' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 TYR A 18 ? TYR A 17 . ? 1_555 ? 2 AC1 5 SER A 19 ? SER A 18 . ? 1_555 ? 3 AC1 5 GLU A 22 ? GLU A 21 . ? 1_555 ? 4 AC1 5 LYS A 25 ? LYS A 24 . ? 1_555 ? 5 AC1 5 HIS A 26 ? HIS A 25 . ? 1_555 ? 6 AC2 4 ASP A 62 ? ASP A 61 . ? 1_555 ? 7 AC2 4 GLU A 63 ? GLU A 62 . ? 1_555 ? 8 AC2 4 ASP A 64 ? ASP A 63 . ? 1_555 ? 9 AC2 4 ASP A 66 ? ASP A 65 . ? 1_555 ? 10 AC3 5 PHE B 15 ? PHE B 14 . ? 1_555 ? 11 AC3 5 SER B 19 ? SER B 18 . ? 1_555 ? 12 AC3 5 ASP B 24 ? ASP B 23 . ? 1_555 ? 13 AC3 5 LYS B 27 ? LYS B 26 . ? 1_555 ? 14 AC3 5 LEU B 28 ? LEU B 27 . ? 1_555 ? 15 AC4 6 ASP B 62 ? ASP B 61 . ? 1_555 ? 16 AC4 6 GLU B 63 ? GLU B 62 . ? 1_555 ? 17 AC4 6 ASP B 64 ? ASP B 63 . ? 1_555 ? 18 AC4 6 ASP B 66 ? ASP B 65 . ? 1_555 ? 19 AC4 6 GLU B 68 ? GLU B 67 . ? 1_555 ? 20 AC4 6 CYS B 69 ? CYS B 68 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OD2 A ASP 23 ? ? HZ3 A LYS 28 ? ? 1.57 2 2 OD1 B ASP 69 ? ? H B PHE 70 ? ? 1.57 3 2 OD1 A ASP 69 ? ? H A PHE 70 ? ? 1.57 4 3 O B VAL 77 ? ? HG1 B THR 81 ? ? 1.50 5 6 O B GLY 64 ? ? H B GLU 67 ? ? 1.47 6 6 O A GLY 64 ? ? H A GLU 67 ? ? 1.47 7 6 O B MET 79 ? ? H B ALA 83 ? ? 1.59 8 6 OD2 B ASP 23 ? ? HZ2 B LYS 28 ? ? 1.60 9 7 O A MET 57 ? ? H A ASP 61 ? ? 1.57 10 7 O B MET 57 ? ? H B ASP 61 ? ? 1.58 11 10 H1 A MET 0 ? ? H A SER 1 ? ? 1.32 12 10 H1 B MET 0 ? ? H B SER 1 ? ? 1.35 13 10 OD1 A ASP 69 ? ? H A GLU 72 ? ? 1.51 14 10 OD1 B ASP 69 ? ? H B GLU 72 ? ? 1.51 15 11 O A SER 41 ? ? H A GLU 46 ? ? 1.51 16 11 O B SER 41 ? ? H B GLU 46 ? ? 1.51 17 12 HG B SER 18 ? ? O B LYS 24 ? ? 1.46 18 12 HG A SER 18 ? ? O A LYS 24 ? ? 1.53 19 12 O A GLU 21 ? ? H A ASP 23 ? ? 1.56 20 14 O A LEU 35 ? ? H A GLU 39 ? ? 1.49 21 14 O B LEU 35 ? ? H B GLU 39 ? ? 1.49 22 15 O A SER 78 ? ? H A THR 82 ? ? 1.58 23 15 O B SER 78 ? ? H B THR 82 ? ? 1.58 24 16 O B GLU 21 ? ? H B ASP 23 ? ? 1.52 25 16 O A GLU 21 ? ? H A ASP 23 ? ? 1.52 26 16 O B LEU 60 ? ? H B GLU 62 ? ? 1.58 27 16 O A LEU 60 ? ? H A GLU 62 ? ? 1.58 28 17 OD1 A ASP 61 ? ? H A GLY 64 ? ? 1.55 29 17 O B HIS 15 ? ? H B GLY 19 ? ? 1.58 30 17 O A HIS 15 ? ? H A GLY 19 ? ? 1.60 31 18 HD1 B HIS 90 ? ? H B GLU 91 ? ? 1.30 32 18 HD1 A HIS 90 ? ? H A GLU 91 ? ? 1.31 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 38 ? ? -48.93 -75.76 2 1 GLU A 39 ? ? -163.04 19.70 3 1 LYS A 48 ? ? -159.00 -61.07 4 1 PHE A 87 ? ? -67.47 17.44 5 1 GLU A 89 ? ? -48.73 -99.15 6 1 ASN B 38 ? ? -49.07 -75.60 7 1 GLU B 39 ? ? -163.38 19.95 8 1 LYS B 48 ? ? -159.01 -60.66 9 1 PHE B 87 ? ? -67.19 16.94 10 1 GLU B 89 ? ? -49.05 -100.17 11 2 ASN A 37 ? ? -58.16 -72.30 12 2 GLU A 39 ? ? -89.91 -77.36 13 2 SER A 41 ? ? -145.24 18.02 14 2 LEU A 44 ? ? -89.99 -75.34 15 2 ASN B 37 ? ? -58.62 -72.05 16 2 GLU B 39 ? ? -89.69 -77.39 17 2 SER B 41 ? ? -145.78 17.82 18 2 LEU B 44 ? ? -90.31 -74.61 19 3 LYS A 24 ? ? -153.47 -37.94 20 3 HIS A 25 ? ? -159.80 75.40 21 3 GLU A 39 ? ? -91.91 -79.69 22 3 SER A 41 ? ? -148.20 -54.16 23 3 GLU A 46 ? ? -179.31 142.70 24 3 LYS A 48 ? ? -161.53 -23.22 25 3 PHE A 88 ? ? -109.97 -89.93 26 3 LYS B 24 ? ? -154.24 -38.82 27 3 HIS B 25 ? ? -159.41 75.65 28 3 GLU B 39 ? ? -91.79 -79.75 29 3 SER B 41 ? ? -147.99 -53.63 30 3 GLU B 46 ? ? -179.09 142.77 31 3 LYS B 48 ? ? -161.22 -23.45 32 3 PHE B 88 ? ? -110.09 -90.02 33 4 LYS A 24 ? ? -160.11 -125.49 34 4 GLU A 39 ? ? -154.58 -14.85 35 4 GLU A 45 ? ? -150.91 10.55 36 4 LYS A 48 ? ? -136.35 -53.49 37 4 PHE A 88 ? ? -90.03 -80.05 38 4 GLU A 89 ? ? -114.65 -73.37 39 4 LYS B 24 ? ? -160.18 -125.19 40 4 GLU B 39 ? ? -154.71 -14.97 41 4 GLU B 45 ? ? -150.95 10.78 42 4 LYS B 48 ? ? -135.89 -53.70 43 4 PHE B 88 ? ? -89.95 -80.02 44 4 GLU B 89 ? ? -114.90 -72.24 45 5 GLU A 21 ? ? -164.97 114.40 46 5 GLU A 39 ? ? -149.54 22.57 47 5 LEU A 44 ? ? -93.86 -71.85 48 5 LYS A 48 ? ? -153.56 -39.57 49 5 PHE A 87 ? ? 45.26 104.73 50 5 GLU B 21 ? ? -164.58 114.44 51 5 GLU B 39 ? ? -149.26 22.65 52 5 LEU B 44 ? ? -93.66 -72.02 53 5 LYS B 48 ? ? -153.57 -39.41 54 5 PHE B 87 ? ? 45.36 104.59 55 6 ASP A 23 ? ? 51.38 177.36 56 6 ASN A 38 ? ? -41.34 -95.89 57 6 SER A 41 ? ? -163.18 -44.87 58 6 LYS A 48 ? ? -91.20 -76.25 59 6 ASP A 65 ? ? 45.50 26.92 60 6 CYS A 84 ? ? -51.09 85.76 61 6 ASP B 23 ? ? 51.15 177.95 62 6 ASN B 38 ? ? -41.60 -95.28 63 6 SER B 41 ? ? -164.56 -44.87 64 6 LYS B 48 ? ? -91.36 -76.16 65 6 ASP B 65 ? ? 45.66 26.95 66 6 CYS B 84 ? ? -51.02 85.84 67 7 HIS A 25 ? ? -177.78 -47.19 68 7 GLU A 39 ? ? -86.92 -75.39 69 7 GLU A 46 ? ? -78.35 -164.46 70 7 ILE A 47 ? ? 56.57 72.60 71 7 GLU A 86 ? ? -152.49 -77.48 72 7 PHE A 87 ? ? 59.78 18.78 73 7 GLU A 89 ? ? 44.13 171.53 74 7 HIS B 25 ? ? -178.45 -47.95 75 7 GLU B 39 ? ? -88.53 -74.98 76 7 GLU B 46 ? ? -78.32 -164.21 77 7 ILE B 47 ? ? 56.84 72.59 78 7 GLU B 86 ? ? -153.29 -76.70 79 7 PHE B 87 ? ? 58.72 19.67 80 7 GLU B 89 ? ? 44.90 170.56 81 8 GLU A 21 ? ? -172.27 -18.47 82 8 HIS A 25 ? ? 39.40 26.82 83 8 GLU A 39 ? ? -57.16 -84.59 84 8 SER A 41 ? ? -166.81 -18.52 85 8 GLU A 45 ? ? -162.20 23.12 86 8 ILE A 47 ? ? -68.28 96.49 87 8 HIS A 85 ? ? -87.96 -145.02 88 8 PHE A 88 ? ? -174.64 24.89 89 8 GLU B 21 ? ? -172.60 -18.30 90 8 HIS B 25 ? ? 39.55 26.99 91 8 GLU B 39 ? ? -57.34 -84.50 92 8 SER B 41 ? ? -166.75 -18.60 93 8 GLU B 45 ? ? -162.19 23.27 94 8 ILE B 47 ? ? -68.54 96.97 95 8 HIS B 85 ? ? -88.04 -145.09 96 8 PHE B 88 ? ? -174.52 24.76 97 9 GLU A 21 ? ? -120.11 -158.60 98 9 LYS A 24 ? ? -89.96 -80.00 99 9 ASN A 38 ? ? -41.86 -81.66 100 9 GLU A 39 ? ? -143.97 -1.28 101 9 GLU A 45 ? ? -89.53 -137.18 102 9 GLU A 46 ? ? 46.05 -137.33 103 9 HIS A 85 ? ? 44.73 -176.26 104 9 GLU A 86 ? ? 43.27 -168.29 105 9 GLU B 21 ? ? -120.02 -158.67 106 9 LYS B 24 ? ? -90.21 -80.04 107 9 ASN B 38 ? ? -41.96 -81.62 108 9 GLU B 39 ? ? -144.13 -1.19 109 9 GLU B 45 ? ? -89.30 -137.02 110 9 GLU B 46 ? ? 45.71 -136.97 111 9 HIS B 85 ? ? 44.60 -176.23 112 9 GLU B 86 ? ? 43.35 -168.40 113 10 SER A 1 ? ? 50.95 83.89 114 10 ASN A 38 ? ? -43.78 -90.74 115 10 GLU A 39 ? ? -144.21 43.87 116 10 GLU A 46 ? ? -172.81 0.12 117 10 LYS A 48 ? ? -127.91 -63.22 118 10 GLU A 86 ? ? -70.46 -154.73 119 10 PHE A 87 ? ? 55.44 90.82 120 10 GLU A 89 ? ? 48.04 -140.07 121 10 SER B 1 ? ? 51.51 83.56 122 10 ASN B 38 ? ? -42.78 -91.89 123 10 GLU B 39 ? ? -143.66 44.34 124 10 GLU B 46 ? ? -173.21 -1.80 125 10 LYS B 48 ? ? -129.78 -63.29 126 10 GLU B 86 ? ? -70.82 -153.65 127 10 PHE B 87 ? ? 54.77 91.55 128 10 GLU B 89 ? ? 48.73 -140.12 129 11 SER A 1 ? ? 52.56 72.23 130 11 GLU A 21 ? ? -146.29 56.86 131 11 GLU A 39 ? ? -108.38 -73.26 132 11 GLU A 46 ? ? 46.34 96.34 133 11 CYS A 84 ? ? -39.93 159.88 134 11 GLU A 86 ? ? 43.73 -154.91 135 11 SER B 1 ? ? 52.71 72.09 136 11 GLU B 21 ? ? -146.22 57.00 137 11 GLU B 39 ? ? -107.59 -73.40 138 11 GLU B 46 ? ? 46.75 95.83 139 11 CYS B 84 ? ? -39.99 159.76 140 11 GLU B 86 ? ? 43.66 -154.77 141 12 GLU A 39 ? ? -90.10 -79.39 142 12 SER A 41 ? ? -158.68 -16.56 143 12 GLU A 46 ? ? -81.25 -142.83 144 12 ILE A 47 ? ? 63.06 78.76 145 12 PHE A 88 ? ? -153.02 88.49 146 12 GLU B 39 ? ? -91.26 -79.82 147 12 SER B 41 ? ? -158.69 -15.61 148 12 GLU B 46 ? ? -84.45 -142.63 149 12 ILE B 47 ? ? 63.39 79.83 150 12 PHE B 88 ? ? -152.32 86.09 151 13 SER A 1 ? ? -163.27 -162.79 152 13 LEU A 40 ? ? 54.13 7.91 153 13 LYS A 48 ? ? -156.24 -35.56 154 13 HIS A 85 ? ? -103.54 57.18 155 13 GLU A 86 ? ? 58.60 19.95 156 13 GLU A 89 ? ? -60.11 -173.54 157 13 SER B 1 ? ? -163.15 -162.86 158 13 LEU B 40 ? ? 54.05 7.88 159 13 LYS B 48 ? ? -155.78 -35.46 160 13 HIS B 85 ? ? -103.79 57.26 161 13 GLU B 86 ? ? 58.54 19.98 162 13 GLU B 89 ? ? -59.74 -173.31 163 14 HIS A 85 ? ? -99.71 -120.84 164 14 GLU A 86 ? ? -89.23 33.49 165 14 PHE A 88 ? ? -143.51 17.96 166 14 GLU A 89 ? ? -61.40 -145.69 167 14 LEU B 40 ? ? 58.64 19.93 168 14 HIS B 85 ? ? -100.00 -121.24 169 14 GLU B 86 ? ? -88.59 33.50 170 14 PHE B 88 ? ? -143.36 17.53 171 14 GLU B 89 ? ? -60.96 -145.55 172 15 GLU A 21 ? ? -108.27 -87.75 173 15 HIS A 25 ? ? -169.64 -48.56 174 15 GLU A 39 ? ? -108.73 -93.31 175 15 LEU A 40 ? ? -50.37 94.89 176 15 HIS A 85 ? ? -82.94 -145.96 177 15 GLU A 89 ? ? -83.17 -130.78 178 15 HIS A 90 ? ? 49.45 90.73 179 15 GLU B 21 ? ? -108.47 -87.67 180 15 HIS B 25 ? ? -169.85 -48.42 181 15 GLU B 39 ? ? -108.76 -92.85 182 15 LEU B 40 ? ? -50.93 94.82 183 15 HIS B 85 ? ? -82.79 -145.97 184 15 GLU B 89 ? ? -82.85 -129.96 185 15 HIS B 90 ? ? 48.22 91.46 186 16 GLU A 21 ? ? -179.03 139.13 187 16 LYS A 24 ? ? -93.15 -80.10 188 16 CYS A 84 ? ? -46.74 107.85 189 16 PHE A 87 ? ? -89.98 -81.41 190 16 PHE A 88 ? ? 38.20 93.35 191 16 HIS A 90 ? ? 49.11 -130.95 192 16 GLU B 21 ? ? -179.26 139.19 193 16 LYS B 24 ? ? -92.91 -80.36 194 16 CYS B 84 ? ? -46.48 107.90 195 16 PHE B 87 ? ? -90.03 -80.72 196 16 PHE B 88 ? ? 37.45 93.10 197 16 HIS B 90 ? ? 49.00 -130.61 198 17 LEU A 40 ? ? -103.81 52.57 199 17 GLU A 46 ? ? -160.39 9.37 200 17 CYS A 84 ? ? -56.87 -171.33 201 17 PHE A 88 ? ? -95.07 -79.56 202 17 LEU B 40 ? ? -102.14 52.06 203 17 GLU B 46 ? ? -160.27 8.37 204 17 CYS B 84 ? ? -58.81 -171.61 205 17 PHE B 88 ? ? -97.07 -79.80 206 18 ASN A 38 ? ? -45.75 -99.17 207 18 SER A 41 ? ? -153.30 -53.88 208 18 LEU A 44 ? ? -90.31 -77.70 209 18 GLU A 45 ? ? 62.79 -124.85 210 18 GLU A 46 ? ? 36.48 -149.32 211 18 ILE A 47 ? ? 56.38 83.32 212 18 PHE A 87 ? ? 40.29 89.93 213 18 ASN B 38 ? ? -45.37 -99.57 214 18 SER B 41 ? ? -153.79 -53.74 215 18 LEU B 44 ? ? -90.84 -77.74 216 18 GLU B 45 ? ? 63.19 -124.40 217 18 GLU B 46 ? ? 36.01 -148.71 218 18 ILE B 47 ? ? 55.91 83.80 219 18 PHE B 87 ? ? 39.93 90.04 220 19 HIS A 42 ? ? -142.13 -5.38 221 19 LEU A 44 ? ? -142.30 -85.68 222 19 GLU A 46 ? ? -98.47 -138.59 223 19 ILE A 47 ? ? 58.67 113.67 224 19 LYS A 48 ? ? -131.48 -34.17 225 19 PHE A 87 ? ? -46.87 -12.45 226 19 HIS A 90 ? ? -110.55 -76.97 227 19 HIS B 42 ? ? -142.15 -5.29 228 19 LEU B 44 ? ? -142.07 -86.06 229 19 GLU B 46 ? ? -98.86 -138.78 230 19 ILE B 47 ? ? 58.88 113.47 231 19 LYS B 48 ? ? -131.35 -34.32 232 19 PHE B 87 ? ? -46.95 -12.24 233 19 HIS B 90 ? ? -109.86 -80.01 234 20 HIS A 25 ? ? -173.22 -60.74 235 20 GLU A 39 ? ? -80.11 -71.34 236 20 SER A 41 ? ? -139.95 -46.76 237 20 GLU A 45 ? ? -146.92 15.06 238 20 LYS A 48 ? ? -150.16 -45.37 239 20 GLU A 86 ? ? 77.16 -28.17 240 20 GLU A 89 ? ? -144.61 -91.39 241 20 HIS B 25 ? ? -173.31 -60.46 242 20 GLU B 39 ? ? -80.00 -71.24 243 20 SER B 41 ? ? -139.95 -46.64 244 20 GLU B 45 ? ? -147.49 15.35 245 20 LYS B 48 ? ? -149.55 -45.76 246 20 GLU B 86 ? ? 76.98 -27.91 247 20 GLU B 89 ? ? -142.72 -93.27 # _pdbx_nmr_ensemble.entry_id 1QLK _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'SEE MAIN REFERENCE' # _pdbx_nmr_representative.entry_id 1QLK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents WATER # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ATMOSPHERIC _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 22mM _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 'SEE MAIN REFERENCE' _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_details.entry_id 1QLK _pdbx_nmr_details.text 'PLEASE SEE MAIN REFERENCE FOR DETAILS' # _pdbx_nmr_refine.entry_id 1QLK _pdbx_nmr_refine.method 'SEE MAIN REFERENCE' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.851 BRUNGER 1 'structure solution' 'X-PLOR V3.851(ONLINE)' 'V3.851(ONLINE)' ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 SER N N N N 271 SER CA C N S 272 SER C C N N 273 SER O O N N 274 SER CB C N N 275 SER OG O N N 276 SER OXT O N N 277 SER H H N N 278 SER H2 H N N 279 SER HA H N N 280 SER HB2 H N N 281 SER HB3 H N N 282 SER HG H N N 283 SER HXT H N N 284 THR N N N N 285 THR CA C N S 286 THR C C N N 287 THR O O N N 288 THR CB C N R 289 THR OG1 O N N 290 THR CG2 C N N 291 THR OXT O N N 292 THR H H N N 293 THR H2 H N N 294 THR HA H N N 295 THR HB H N N 296 THR HG1 H N N 297 THR HG21 H N N 298 THR HG22 H N N 299 THR HG23 H N N 300 THR HXT H N N 301 TYR N N N N 302 TYR CA C N S 303 TYR C C N N 304 TYR O O N N 305 TYR CB C N N 306 TYR CG C Y N 307 TYR CD1 C Y N 308 TYR CD2 C Y N 309 TYR CE1 C Y N 310 TYR CE2 C Y N 311 TYR CZ C Y N 312 TYR OH O N N 313 TYR OXT O N N 314 TYR H H N N 315 TYR H2 H N N 316 TYR HA H N N 317 TYR HB2 H N N 318 TYR HB3 H N N 319 TYR HD1 H N N 320 TYR HD2 H N N 321 TYR HE1 H N N 322 TYR HE2 H N N 323 TYR HH H N N 324 TYR HXT H N N 325 VAL N N N N 326 VAL CA C N S 327 VAL C C N N 328 VAL O O N N 329 VAL CB C N N 330 VAL CG1 C N N 331 VAL CG2 C N N 332 VAL OXT O N N 333 VAL H H N N 334 VAL H2 H N N 335 VAL HA H N N 336 VAL HB H N N 337 VAL HG11 H N N 338 VAL HG12 H N N 339 VAL HG13 H N N 340 VAL HG21 H N N 341 VAL HG22 H N N 342 VAL HG23 H N N 343 VAL HXT H N N 344 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 THR N CA sing N N 271 THR N H sing N N 272 THR N H2 sing N N 273 THR CA C sing N N 274 THR CA CB sing N N 275 THR CA HA sing N N 276 THR C O doub N N 277 THR C OXT sing N N 278 THR CB OG1 sing N N 279 THR CB CG2 sing N N 280 THR CB HB sing N N 281 THR OG1 HG1 sing N N 282 THR CG2 HG21 sing N N 283 THR CG2 HG22 sing N N 284 THR CG2 HG23 sing N N 285 THR OXT HXT sing N N 286 TYR N CA sing N N 287 TYR N H sing N N 288 TYR N H2 sing N N 289 TYR CA C sing N N 290 TYR CA CB sing N N 291 TYR CA HA sing N N 292 TYR C O doub N N 293 TYR C OXT sing N N 294 TYR CB CG sing N N 295 TYR CB HB2 sing N N 296 TYR CB HB3 sing N N 297 TYR CG CD1 doub Y N 298 TYR CG CD2 sing Y N 299 TYR CD1 CE1 sing Y N 300 TYR CD1 HD1 sing N N 301 TYR CD2 CE2 doub Y N 302 TYR CD2 HD2 sing N N 303 TYR CE1 CZ doub Y N 304 TYR CE1 HE1 sing N N 305 TYR CE2 CZ sing Y N 306 TYR CE2 HE2 sing N N 307 TYR CZ OH sing N N 308 TYR OH HH sing N N 309 TYR OXT HXT sing N N 310 VAL N CA sing N N 311 VAL N H sing N N 312 VAL N H2 sing N N 313 VAL CA C sing N N 314 VAL CA CB sing N N 315 VAL CA HA sing N N 316 VAL C O doub N N 317 VAL C OXT sing N N 318 VAL CB CG1 sing N N 319 VAL CB CG2 sing N N 320 VAL CB HB sing N N 321 VAL CG1 HG11 sing N N 322 VAL CG1 HG12 sing N N 323 VAL CG1 HG13 sing N N 324 VAL CG2 HG21 sing N N 325 VAL CG2 HG22 sing N N 326 VAL CG2 HG23 sing N N 327 VAL OXT HXT sing N N 328 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600.13 # _atom_sites.entry_id 1QLK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_