data_1QLS # _entry.id 1QLS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.305 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1QLS PDBE EBI-2868 WWPDB D_1290002868 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1A4P unspecified 'P11 (S100A10), LIGAND OF ANNEXIN II CALPACTIN LIGHT CHAIN' PDB 1BT6 unspecified 'P11 (S100A10), LIGAND OF ANNEXIN II IN COMPLEX WITH ANNEXIN II N-TERMINUS (HUMAN)' PDB 1BO9 unspecified 'NMR SOLUTION STRUCTURE OF DOMAIN 1 OF HUMAN ANNIXIN I' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QLS _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 1999-09-15 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rety, S.' 1 'Sopkova, J.' 2 'Renouard, M.' 3 'Osterloh, D.' 4 'Gerke, V.' 5 'Russo-Marie, F.' 6 'Lewit-Bentley, A.' 7 # _citation.id primary _citation.title 'Structural Basis of the Ca2+ Dependent Association between S100C (S100A11) and its Target, the N-Terminal Part of Annexin I' _citation.journal_abbrev Structure _citation.journal_volume 8 _citation.page_first 175 _citation.page_last ? _citation.year 2000 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10673436 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(00)00093-9' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rety, S.' 1 ? primary 'Osterloh, D.' 2 ? primary 'Arie, J.P.' 3 ? primary 'Tabaries, S.' 4 ? primary 'Seeman, J.' 5 ? primary 'Russo-Marie, F.' 6 ? primary 'Gerke, V.' 7 ? primary 'Lewit-Bentley, A.' 8 ? # _cell.entry_id 1QLS _cell.length_a 77.510 _cell.length_b 77.510 _cell.length_c 111.610 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QLS _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'S100C PROTEIN' 11194.829 1 ? ? ? ? 2 polymer syn 'ANNEXIN I' 1278.541 1 ? ? N-TERMINAL 'N-ACETYLATED ON N-TERMINUS' 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 4 water nat water 18.015 23 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CALGIZZARIN # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAKRPTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTELAAFTQNQKDPGVLDRMMKKLDLDSDGQLDFQEFLN LIGGLAIACHDSFIKSTQK ; ;MAKRPTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTELAAFTQNQKDPGVLDRMMKKLDLDSDGQLDFQEFLN LIGGLAIACHDSFIKSTQK ; A ? 2 'polypeptide(L)' no yes '(ACE)AMVSAFLKQAW' XAMVSAFLKQAW D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LYS n 1 4 ARG n 1 5 PRO n 1 6 THR n 1 7 GLU n 1 8 THR n 1 9 GLU n 1 10 ARG n 1 11 CYS n 1 12 ILE n 1 13 GLU n 1 14 SER n 1 15 LEU n 1 16 ILE n 1 17 ALA n 1 18 ILE n 1 19 PHE n 1 20 GLN n 1 21 LYS n 1 22 HIS n 1 23 ALA n 1 24 GLY n 1 25 ARG n 1 26 ASP n 1 27 GLY n 1 28 ASN n 1 29 ASN n 1 30 THR n 1 31 LYS n 1 32 ILE n 1 33 SER n 1 34 LYS n 1 35 THR n 1 36 GLU n 1 37 PHE n 1 38 LEU n 1 39 ILE n 1 40 PHE n 1 41 MET n 1 42 ASN n 1 43 THR n 1 44 GLU n 1 45 LEU n 1 46 ALA n 1 47 ALA n 1 48 PHE n 1 49 THR n 1 50 GLN n 1 51 ASN n 1 52 GLN n 1 53 LYS n 1 54 ASP n 1 55 PRO n 1 56 GLY n 1 57 VAL n 1 58 LEU n 1 59 ASP n 1 60 ARG n 1 61 MET n 1 62 MET n 1 63 LYS n 1 64 LYS n 1 65 LEU n 1 66 ASP n 1 67 LEU n 1 68 ASP n 1 69 SER n 1 70 ASP n 1 71 GLY n 1 72 GLN n 1 73 LEU n 1 74 ASP n 1 75 PHE n 1 76 GLN n 1 77 GLU n 1 78 PHE n 1 79 LEU n 1 80 ASN n 1 81 LEU n 1 82 ILE n 1 83 GLY n 1 84 GLY n 1 85 LEU n 1 86 ALA n 1 87 ILE n 1 88 ALA n 1 89 CYS n 1 90 HIS n 1 91 ASP n 1 92 SER n 1 93 PHE n 1 94 ILE n 1 95 LYS n 1 96 SER n 1 97 THR n 1 98 GLN n 1 99 LYS n 2 1 ACE n 2 2 ALA n 2 3 MET n 2 4 VAL n 2 5 SER n 2 6 ALA n 2 7 PHE n 2 8 LEU n 2 9 LYS n 2 10 GLN n 2 11 ALA n 2 12 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name PIG _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'SUS SCROFA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET23A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'HOMO SAPIENS' _pdbx_entity_src_syn.organism_common_name HUMAN _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP S111_PIG 1 ? ? P31950 ? 2 UNP ANX1_HUMAN 2 ? ? P04083 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1QLS A 1 ? 99 ? P31950 1 ? 99 ? 1 99 2 2 1QLS D 2 ? 12 ? P04083 1 ? 11 ? 1 11 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 1QLS _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id D _struct_ref_seq_dif.seq_num 6 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P04083 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 5 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 5 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1QLS _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.9 _exptl_crystal.density_percent_sol 68.2 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;20 MG/ML PROTEIN WERE CRYSTALLIZED BY VAPOR DIFFUSION AGAINST 10% PEG 4000, 20% PEG 4000, 10% 2-PROPANOL, 100MM HEPES, PH=8.5, pH 8.50 ; # _diffrn.id 1 _diffrn.ambient_temp 280.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1998-07-02 _diffrn_detector.details 'FOCUSSING MONOCHROMATOR' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GE(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.37 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'LURE BEAMLINE D41A' _diffrn_source.pdbx_synchrotron_site LURE _diffrn_source.pdbx_synchrotron_beamline D41A _diffrn_source.pdbx_wavelength 1.37 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1QLS _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 69.000 _reflns.d_resolution_high 2.300 _reflns.number_obs 9310 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.08000 _reflns.pdbx_Rsym_value 0.08000 _reflns.pdbx_netI_over_sigmaI 20.1000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.600 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1QLS _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 9333 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20. _refine.ls_d_res_high 2.3 _refine.ls_percent_reflns_obs 99.7 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.214 _refine.ls_R_factor_R_free 0.268 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 930 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 200.109 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 1BT6 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.217 _refine.pdbx_overall_ESU_R_Free 0.207 _refine.overall_SU_ML 0.1216 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 4.869 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 840 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 865 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 20. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.017 0.020 ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.035 0.030 ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.054 0.05 ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it 2.417 2.0 ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it 3.357 3.0 ? ? 'X-RAY DIFFRACTION' ? p_scbond_it 4.480 3.0 ? ? 'X-RAY DIFFRACTION' ? p_scangle_it 6.602 4.0 ? ? 'X-RAY DIFFRACTION' ? p_plane_restr 0.009 0.02 ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr 0.203 0.15 ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd 0.206 0.300 ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd 0.350 0.300 ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd 0.189 0.3 ? ? 'X-RAY DIFFRACTION' ? p_planar_tor 2.1 15.0 ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor 23.0 15.0 ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor 21.8 20.0 ? ? 'X-RAY DIFFRACTION' ? p_special_tor 0. 15.0 ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1QLS _struct.title 'S100C (S100A11),OR CALGIZZARIN, IN COMPLEX WITH ANNEXIN I N-TERMINUS' _struct.pdbx_descriptor 'S100C PROTEIN, ANNEXIN I' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QLS _struct_keywords.pdbx_keywords 'METAL-BINDING PROTEIN/INHIBITOR' _struct_keywords.text ;METAL-BINDING PROTEIN/INHIBITOR, S100 FAMILY, EF-HAND PROTEIN, COMPLEX (LIGAND-ANNEXIN), LIGAND OF ANNEXIN II, CALCIUM/PHOSPHOLIPID BINDING PROTEIN, METAL-BINDING PROTEIN-INHIBITOR complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.details ;BIOLOGICAL_UNIT: DIMERTHE DIMER IS COVALENT IN THE CRYSTAL, LINKED BY ADISULPHIDE AT CYS11. UNDER REDUCING CONDITIONS, THOUGHTHE DISULPHIDE WOULD BE REDUCED, THE DIMER SHOULD REMAININTACT.FOR THE HOMO-ASSEMBLY DESCRIBED BY REMARK 350THE DIFFERENCE IN ACCESSIBLE SURFACE AREA PERCHAIN BETWEEN THE ISOLATED CHAIN AND THAT FOR ; # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? GLY A 24 ? THR A 6 GLY A 24 1 ? 19 HELX_P HELX_P2 2 SER A 33 ? THR A 43 ? SER A 33 THR A 43 1 ? 11 HELX_P HELX_P3 3 ALA A 46 ? ASN A 51 ? ALA A 46 ASN A 51 1 ? 6 HELX_P HELX_P4 4 GLY A 56 ? LEU A 65 ? GLY A 56 LEU A 65 1 ? 10 HELX_P HELX_P5 5 PHE A 75 ? THR A 97 ? PHE A 75 THR A 97 1 ? 23 HELX_P HELX_P6 1D MET B 3 ? GLN B 10 ? MET D 2 GLN D 9 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 11 A CYS 11 8_676 ? ? ? ? ? ? ? 1.923 ? metalc1 metalc ? ? C CA . CA ? ? ? 1_555 A ALA 23 O ? ? A CA 101 A ALA 23 1_555 ? ? ? ? ? ? ? 2.481 ? metalc2 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 36 OE2 ? ? A CA 101 A GLU 36 1_555 ? ? ? ? ? ? ? 2.819 ? metalc3 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 26 OD1 ? ? A CA 101 A ASP 26 1_555 ? ? ? ? ? ? ? 2.544 ? metalc4 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 101 A HOH 2017 1_555 ? ? ? ? ? ? ? 2.490 ? metalc5 metalc ? ? C CA . CA ? ? ? 1_555 A LYS 31 O ? ? A CA 101 A LYS 31 1_555 ? ? ? ? ? ? ? 2.557 ? metalc6 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 36 OE1 ? ? A CA 101 A GLU 36 1_555 ? ? ? ? ? ? ? 2.628 ? metalc7 metalc ? ? C CA . CA ? ? ? 1_555 A ASN 28 O ? ? A CA 101 A ASN 28 1_555 ? ? ? ? ? ? ? 2.685 ? metalc8 metalc ? ? D CA . CA ? ? ? 1_555 A GLN 72 O ? ? A CA 102 A GLN 72 1_555 ? ? ? ? ? ? ? 2.625 ? metalc9 metalc ? ? D CA . CA ? ? ? 1_555 A GLU 77 OE1 ? ? A CA 102 A GLU 77 1_555 ? ? ? ? ? ? ? 2.735 ? metalc10 metalc ? ? D CA . CA ? ? ? 1_555 A GLU 77 OE2 ? ? A CA 102 A GLU 77 1_555 ? ? ? ? ? ? ? 2.793 ? metalc11 metalc ? ? D CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 102 A HOH 2013 1_555 ? ? ? ? ? ? ? 2.703 ? metalc12 metalc ? ? D CA . CA ? ? ? 1_555 A ASP 66 OD1 ? ? A CA 102 A ASP 66 1_555 ? ? ? ? ? ? ? 2.559 ? metalc13 metalc ? ? D CA . CA ? ? ? 1_555 A ASP 68 OD1 ? ? A CA 102 A ASP 68 1_555 ? ? ? ? ? ? ? 2.601 ? metalc14 metalc ? ? D CA . CA ? ? ? 1_555 A ASP 70 OD1 ? ? A CA 102 A ASP 70 1_555 ? ? ? ? ? ? ? 2.641 ? covale1 covale both ? B ACE 1 C ? ? ? 1_555 B ALA 2 N ? ? D ACE 0 D ALA 1 1_555 ? ? ? ? ? ? ? 1.334 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? covale ? ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id S1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 LYS A 31 ? SER A 33 ? LYS A 31 SER A 33 S1 2 GLN A 72 ? ASP A 74 ? GLN A 72 ASP A 74 # _pdbx_struct_sheet_hbond.sheet_id S1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 73 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 73 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 32 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 32 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 101' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ALA A 23 ? ALA A 23 . ? 1_555 ? 2 AC1 6 ASP A 26 ? ASP A 26 . ? 1_555 ? 3 AC1 6 ASN A 28 ? ASN A 28 . ? 1_555 ? 4 AC1 6 LYS A 31 ? LYS A 31 . ? 1_555 ? 5 AC1 6 GLU A 36 ? GLU A 36 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 2017 . ? 1_555 ? 7 AC2 6 ASP A 66 ? ASP A 66 . ? 1_555 ? 8 AC2 6 ASP A 68 ? ASP A 68 . ? 1_555 ? 9 AC2 6 ASP A 70 ? ASP A 70 . ? 1_555 ? 10 AC2 6 GLN A 72 ? GLN A 72 . ? 1_555 ? 11 AC2 6 GLU A 77 ? GLU A 77 . ? 1_555 ? 12 AC2 6 HOH E . ? HOH A 2013 . ? 1_555 ? # _database_PDB_matrix.entry_id 1QLS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QLS _atom_sites.fract_transf_matrix[1][1] 0.012901 _atom_sites.fract_transf_matrix[1][2] 0.007449 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014897 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008960 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LYS 99 99 99 LYS LYS A . n B 2 1 ACE 1 0 0 ACE ACE D . n B 2 2 ALA 2 1 1 ALA ALA D . n B 2 3 MET 3 2 2 MET MET D . n B 2 4 VAL 4 3 3 VAL VAL D . n B 2 5 SER 5 4 4 SER SER D . n B 2 6 ALA 6 5 5 ALA ALA D . n B 2 7 PHE 7 6 6 PHE PHE D . n B 2 8 LEU 8 7 7 LEU LEU D . n B 2 9 LYS 9 8 8 LYS LYS D . n B 2 10 GLN 10 9 9 GLN GLN D . n B 2 11 ALA 11 10 10 ALA ALA D . n B 2 12 TRP 12 11 11 TRP TRP D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 101 101 CA CA A . D 3 CA 1 102 102 CA CA A . E 4 HOH 1 2001 2001 HOH HOH A . E 4 HOH 2 2002 2002 HOH HOH A . E 4 HOH 3 2003 2003 HOH HOH A . E 4 HOH 4 2004 2004 HOH HOH A . E 4 HOH 5 2005 2005 HOH HOH A . E 4 HOH 6 2006 2006 HOH HOH A . E 4 HOH 7 2007 2007 HOH HOH A . E 4 HOH 8 2008 2008 HOH HOH A . E 4 HOH 9 2009 2009 HOH HOH A . E 4 HOH 10 2010 2010 HOH HOH A . E 4 HOH 11 2011 2011 HOH HOH A . E 4 HOH 12 2012 2012 HOH HOH A . E 4 HOH 13 2013 2013 HOH HOH A . E 4 HOH 14 2014 2014 HOH HOH A . E 4 HOH 15 2015 2015 HOH HOH A . E 4 HOH 16 2016 2016 HOH HOH A . E 4 HOH 17 2017 2017 HOH HOH A . E 4 HOH 18 2018 2018 HOH HOH A . E 4 HOH 19 2019 2019 HOH HOH A . E 4 HOH 20 2020 2020 HOH HOH A . E 4 HOH 21 2021 2021 HOH HOH A . E 4 HOH 22 2022 2022 HOH HOH A . E 4 HOH 23 2023 2023 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5820 ? 1 MORE -59.1 ? 1 'SSA (A^2)' 12460 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_676 x-y+1,-y+2,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 134.2512580947 0.0000000000 0.0000000000 -1.0000000000 111.6100000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ALA 23 ? A ALA 23 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 36 ? A GLU 36 ? 1_555 74.5 ? 2 O ? A ALA 23 ? A ALA 23 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 26 ? A ASP 26 ? 1_555 99.7 ? 3 OE2 ? A GLU 36 ? A GLU 36 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 26 ? A ASP 26 ? 1_555 72.3 ? 4 O ? A ALA 23 ? A ALA 23 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 2017 ? 1_555 173.9 ? 5 OE2 ? A GLU 36 ? A GLU 36 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 2017 ? 1_555 111.3 ? 6 OD1 ? A ASP 26 ? A ASP 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? E HOH . ? A HOH 2017 ? 1_555 80.7 ? 7 O ? A ALA 23 ? A ALA 23 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A LYS 31 ? A LYS 31 ? 1_555 98.1 ? 8 OE2 ? A GLU 36 ? A GLU 36 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A LYS 31 ? A LYS 31 ? 1_555 121.4 ? 9 OD1 ? A ASP 26 ? A ASP 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A LYS 31 ? A LYS 31 ? 1_555 160.1 ? 10 O ? E HOH . ? A HOH 2017 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A LYS 31 ? A LYS 31 ? 1_555 80.6 ? 11 O ? A ALA 23 ? A ALA 23 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 36 ? A GLU 36 ? 1_555 96.7 ? 12 OE2 ? A GLU 36 ? A GLU 36 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 36 ? A GLU 36 ? 1_555 46.7 ? 13 OD1 ? A ASP 26 ? A ASP 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 36 ? A GLU 36 ? 1_555 108.3 ? 14 O ? E HOH . ? A HOH 2017 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 36 ? A GLU 36 ? 1_555 88.9 ? 15 O ? A LYS 31 ? A LYS 31 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 36 ? A GLU 36 ? 1_555 78.2 ? 16 O ? A ALA 23 ? A ALA 23 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A ASN 28 ? A ASN 28 ? 1_555 78.0 ? 17 OE2 ? A GLU 36 ? A GLU 36 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A ASN 28 ? A ASN 28 ? 1_555 143.7 ? 18 OD1 ? A ASP 26 ? A ASP 26 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A ASN 28 ? A ASN 28 ? 1_555 89.7 ? 19 O ? E HOH . ? A HOH 2017 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A ASN 28 ? A ASN 28 ? 1_555 96.0 ? 20 O ? A LYS 31 ? A LYS 31 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A ASN 28 ? A ASN 28 ? 1_555 85.4 ? 21 OE1 ? A GLU 36 ? A GLU 36 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A ASN 28 ? A ASN 28 ? 1_555 161.9 ? 22 O ? A GLN 72 ? A GLN 72 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 80.7 ? 23 O ? A GLN 72 ? A GLN 72 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 120.7 ? 24 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 46.9 ? 25 O ? A GLN 72 ? A GLN 72 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 2013 ? 1_555 93.7 ? 26 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 2013 ? 1_555 84.6 ? 27 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O ? E HOH . ? A HOH 2013 ? 1_555 104.7 ? 28 O ? A GLN 72 ? A GLN 72 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 89.5 ? 29 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 116.4 ? 30 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 91.3 ? 31 O ? E HOH . ? A HOH 2013 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 159.0 ? 32 O ? A GLN 72 ? A GLN 72 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 159.6 ? 33 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 119.6 ? 34 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 77.7 ? 35 O ? E HOH . ? A HOH 2013 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 89.3 ? 36 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 80.8 ? 37 O ? A GLN 72 ? A GLN 72 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70 ? 1_555 76.3 ? 38 OE1 ? A GLU 77 ? A GLU 77 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70 ? 1_555 147.2 ? 39 OE2 ? A GLU 77 ? A GLU 77 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70 ? 1_555 162.9 ? 40 O ? E HOH . ? A HOH 2013 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70 ? 1_555 74.0 ? 41 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70 ? 1_555 86.7 ? 42 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 70 ? A ASP 70 ? 1_555 85.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-02-25 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Experimental preparation' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 4 'Structure model' pdbx_database_proc 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.method' 2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement . ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 AMoRE phasing . ? 4 # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ; HELIX DETERMINATION METHOD: AUTHOR PROVIDED. ; 700 ; SHEET DETERMINATION METHOD: AUTHOR PROVIDED. ; # _pdbx_entry_details.entry_id 1QLS _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'SYNTHETIC ANNEXIN I N-TERMINAL SEQUENCE' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 116.98 120.30 -3.32 0.50 N 2 1 CB A ASP 26 ? ? CG A ASP 26 ? ? OD2 A ASP 26 ? ? 130.73 118.30 12.43 0.90 N 3 1 CD A ARG 60 ? ? NE A ARG 60 ? ? CZ A ARG 60 ? ? 132.20 123.60 8.60 1.40 N 4 1 NE A ARG 60 ? ? CZ A ARG 60 ? ? NH1 A ARG 60 ? ? 125.22 120.30 4.92 0.50 N 5 1 CB A ASP 66 ? ? CG A ASP 66 ? ? OD2 A ASP 66 ? ? 132.50 118.30 14.20 0.90 N 6 1 CB A ASP 68 ? ? CG A ASP 68 ? ? OD2 A ASP 68 ? ? 125.31 118.30 7.01 0.90 N 7 1 CB A ASP 74 ? ? CG A ASP 74 ? ? OD1 A ASP 74 ? ? 125.83 118.30 7.53 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 26 ? ? -98.96 -159.03 2 1 THR A 43 ? ? -132.16 -38.37 3 1 GLN A 98 ? ? -114.01 65.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A ARG 4 ? A ARG 4 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 water HOH #