data_1QM9 # _entry.id 1QM9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1QM9 PDBE EBI-4149 WWPDB D_1290004149 BMRB 5409 # _pdbx_database_related.db_id 5409 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QM9 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 1999-09-22 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Conte, M.R.' 1 'Grune, T.' 2 'Curry, S.' 3 'Matthews, S.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of Tandem RNA Recognition Motifs from Polypyrimidine Tract Binding Protein Reveals Novel Features of the Rrm Fold' 'Embo J.' 19 3132 ? 2000 EMJODG UK 0261-4189 0897 ? 10856256 10.1093/EMBOJ/19.12.3132 1 ;Resonance Assignment and Topology of a 22kDa C-Terminal Fragment of the Polypyriine Tract Binding Protein Containing Two RNA Binding Domain ; J.Biomol.NMR 14 383 ? 1999 JBNME9 NE 0925-2738 0800 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Conte, M.R.' 1 primary 'Grune, T.' 2 primary 'Kelly, G.' 3 primary 'Ladas, A.' 4 primary 'Matthews, S.' 5 primary 'Curry, S.' 6 1 'Conte, M.R.' 7 1 'Grune, T.' 8 1 'Curry, S.' 9 1 'Matthews, S.' 10 # _cell.entry_id 1QM9 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QM9 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'POLYPYRIMIDINE TRACT-BINDING PROTEIN' _entity.formula_weight 22117.322 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RNA BINDING FRAGMENT' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PTB, PTB-C198, HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN I, HNRNP I, 57 KD RNA-BINDING PROTEIN PPTB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQN VQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKM ALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI ; _entity_poly.pdbx_seq_one_letter_code_can ;MGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQN VQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKM ALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASN n 1 4 SER n 1 5 VAL n 1 6 LEU n 1 7 LEU n 1 8 VAL n 1 9 SER n 1 10 ASN n 1 11 LEU n 1 12 ASN n 1 13 PRO n 1 14 GLU n 1 15 ARG n 1 16 VAL n 1 17 THR n 1 18 PRO n 1 19 GLN n 1 20 SER n 1 21 LEU n 1 22 PHE n 1 23 ILE n 1 24 LEU n 1 25 PHE n 1 26 GLY n 1 27 VAL n 1 28 TYR n 1 29 GLY n 1 30 ASP n 1 31 VAL n 1 32 GLN n 1 33 ARG n 1 34 VAL n 1 35 LYS n 1 36 ILE n 1 37 LEU n 1 38 PHE n 1 39 ASN n 1 40 LYS n 1 41 LYS n 1 42 GLU n 1 43 ASN n 1 44 ALA n 1 45 LEU n 1 46 VAL n 1 47 GLN n 1 48 MET n 1 49 ALA n 1 50 ASP n 1 51 GLY n 1 52 ASN n 1 53 GLN n 1 54 ALA n 1 55 GLN n 1 56 LEU n 1 57 ALA n 1 58 MET n 1 59 SER n 1 60 HIS n 1 61 LEU n 1 62 ASN n 1 63 GLY n 1 64 HIS n 1 65 LYS n 1 66 LEU n 1 67 HIS n 1 68 GLY n 1 69 LYS n 1 70 PRO n 1 71 ILE n 1 72 ARG n 1 73 ILE n 1 74 THR n 1 75 LEU n 1 76 SER n 1 77 LYS n 1 78 HIS n 1 79 GLN n 1 80 ASN n 1 81 VAL n 1 82 GLN n 1 83 LEU n 1 84 PRO n 1 85 ARG n 1 86 GLU n 1 87 GLY n 1 88 GLN n 1 89 GLU n 1 90 ASP n 1 91 GLN n 1 92 GLY n 1 93 LEU n 1 94 THR n 1 95 LYS n 1 96 ASP n 1 97 TYR n 1 98 GLY n 1 99 ASN n 1 100 SER n 1 101 PRO n 1 102 LEU n 1 103 HIS n 1 104 ARG n 1 105 PHE n 1 106 LYS n 1 107 LYS n 1 108 PRO n 1 109 GLY n 1 110 SER n 1 111 LYS n 1 112 ASN n 1 113 PHE n 1 114 GLN n 1 115 ASN n 1 116 ILE n 1 117 PHE n 1 118 PRO n 1 119 PRO n 1 120 SER n 1 121 ALA n 1 122 THR n 1 123 LEU n 1 124 HIS n 1 125 LEU n 1 126 SER n 1 127 ASN n 1 128 ILE n 1 129 PRO n 1 130 PRO n 1 131 SER n 1 132 VAL n 1 133 SER n 1 134 GLU n 1 135 GLU n 1 136 ASP n 1 137 LEU n 1 138 LYS n 1 139 VAL n 1 140 LEU n 1 141 PHE n 1 142 SER n 1 143 SER n 1 144 ASN n 1 145 GLY n 1 146 GLY n 1 147 VAL n 1 148 VAL n 1 149 LYS n 1 150 GLY n 1 151 PHE n 1 152 LYS n 1 153 PHE n 1 154 PHE n 1 155 GLN n 1 156 LYS n 1 157 ASP n 1 158 ARG n 1 159 LYS n 1 160 MET n 1 161 ALA n 1 162 LEU n 1 163 ILE n 1 164 GLN n 1 165 MET n 1 166 GLY n 1 167 SER n 1 168 VAL n 1 169 GLU n 1 170 GLU n 1 171 ALA n 1 172 VAL n 1 173 GLN n 1 174 ALA n 1 175 LEU n 1 176 ILE n 1 177 ASP n 1 178 LEU n 1 179 HIS n 1 180 ASN n 1 181 HIS n 1 182 ASP n 1 183 LEU n 1 184 GLY n 1 185 GLU n 1 186 ASN n 1 187 HIS n 1 188 HIS n 1 189 LEU n 1 190 ARG n 1 191 VAL n 1 192 SER n 1 193 PHE n 1 194 SER n 1 195 LYS n 1 196 SER n 1 197 THR n 1 198 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location NUCLEUS/CYTOPLASM _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTB_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P26599 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QM9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 198 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P26599 _struct_ref_seq.db_align_beg 335 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 531 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 198 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1QM9 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P26599 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type HSQC-NOESY-HSQC _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 302.00 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.00 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1QM9 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1QM9 _pdbx_nmr_details.text ;MEAN STRUCTURE. REPRESENTATIVE STRUCTURE. THIS STRUCTURE WAS DETERMINED BY MULTINUCLEAR NMR EXPERIMENTS THE ORIENTATION OF THE TWO RNP DOMAINS (RESIDUES 1-98 AND 120-198 RESPECTIVELY) IS NOT DEFINED WITH RESPECT TO EACH OTHER. THIS ENTRY IS REPRESENTATIVE STRUCTURE FROM THE LOWEST ENERGY FAMILY. ; # _pdbx_nmr_ensemble.entry_id 1QM9 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST ENERGY' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR ? BRUNGER 1 'structure solution' 'AURELIA XPLOR' XPLOR ? 2 # _exptl.entry_id 1QM9 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1QM9 _struct.title 'NMR, REPRESENTATIVE STRUCTURE' _struct.pdbx_descriptor 'POLYPYRIMIDINE TRACT-BINDING PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'MINIMIZED AVERAGE' # _struct_keywords.entry_id 1QM9 _struct_keywords.pdbx_keywords RIBONUCLEOPROTEIN _struct_keywords.text 'RIBONUCLEOPROTEIN, POLYPYRIMIDINE TRACT BINDING PROTEIN, RNP, RNA, SPICING, TRANSLATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 18 ? TYR A 28 ? PRO A 18 TYR A 28 1 ? 11 HELX_P HELX_P2 2 ASN A 52 ? LEU A 61 ? ASN A 52 LEU A 61 1 ? 10 HELX_P HELX_P3 3 GLU A 134 ? SER A 143 ? GLU A 134 SER A 143 1 ? 10 HELX_P HELX_P4 4 VAL A 168 ? LEU A 178 ? VAL A 168 LEU A 178 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 72 ? LEU A 75 ? ARG A 72 LEU A 75 A 2 VAL A 5 ? SER A 9 ? VAL A 5 SER A 9 A 3 LEU A 45 ? GLN A 47 ? LEU A 45 GLN A 47 A 4 ARG A 33 ? LYS A 35 ? ARG A 33 LYS A 35 A 5 THR A 94 ? ASP A 96 ? THR A 94 ASP A 96 B 1 VAL A 191 ? SER A 194 ? VAL A 191 SER A 194 B 2 THR A 122 ? LEU A 125 ? THR A 122 LEU A 125 B 3 ALA A 161 ? GLN A 164 ? ALA A 161 GLN A 164 B 4 GLY A 150 ? PHE A 153 ? GLY A 150 PHE A 153 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 72 ? O ARG A 72 N SER A 9 ? N SER A 9 A 2 3 O LYS A 35 ? O LYS A 35 N LEU A 45 ? N LEU A 45 A 3 4 O GLN A 47 ? O GLN A 47 N ARG A 33 ? N ARG A 33 A 4 5 O VAL A 34 ? O VAL A 34 N LYS A 95 ? N LYS A 95 B 1 2 O SER A 194 ? O SER A 194 N THR A 122 ? N THR A 122 B 2 3 O LEU A 125 ? O LEU A 125 N ALA A 161 ? N ALA A 161 B 3 4 O GLN A 164 ? O GLN A 164 N GLY A 150 ? N GLY A 150 # _database_PDB_matrix.entry_id 1QM9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QM9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 MET 160 160 160 MET MET A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 MET 165 165 165 MET MET A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 HIS 179 179 179 HIS HIS A . n A 1 180 ASN 180 180 180 ASN ASN A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 ASP 182 182 182 ASP ASP A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 ASN 186 186 186 ASN ASN A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 ILE 198 198 198 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-07-03 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PRO 18 ? ? H A PHE 22 ? ? 1.48 2 1 O A LEU 11 ? ? H A GLU 42 ? ? 1.53 3 1 O A GLN 53 ? ? H A ALA 57 ? ? 1.55 4 1 O A GLY 26 ? ? H A GLY 29 ? ? 1.56 5 1 O A LEU 140 ? ? H A GLY 145 ? ? 1.58 6 1 O A GLN 173 ? ? H A ASP 177 ? ? 1.58 7 1 O A PHE 22 ? ? H A GLY 26 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 4 ? ? -164.17 63.75 2 1 ASN A 10 ? ? -179.96 -82.18 3 1 LEU A 11 ? ? -1.74 75.40 4 1 ASN A 12 ? ? -96.26 -65.78 5 1 PRO A 13 ? ? -71.86 -166.41 6 1 VAL A 27 ? ? -38.01 -31.63 7 1 LEU A 37 ? ? -175.88 -85.19 8 1 LYS A 41 ? ? 57.05 157.33 9 1 MET A 48 ? ? -167.44 -39.79 10 1 ASP A 50 ? ? 39.89 19.85 11 1 LYS A 65 ? ? 70.32 94.60 12 1 LYS A 77 ? ? -101.65 -90.63 13 1 HIS A 78 ? ? 53.64 91.36 14 1 ASN A 80 ? ? -52.96 -170.19 15 1 PRO A 84 ? ? -72.76 -160.77 16 1 GLU A 86 ? ? -159.97 38.50 17 1 GLU A 89 ? ? 168.41 10.44 18 1 TYR A 97 ? ? -25.32 135.08 19 1 ASN A 99 ? ? 178.24 158.86 20 1 LYS A 106 ? ? -73.72 -151.27 21 1 LYS A 107 ? ? -51.28 107.17 22 1 ASN A 112 ? ? -105.41 -139.04 23 1 PHE A 113 ? ? 56.15 101.97 24 1 GLN A 114 ? ? -170.11 60.49 25 1 ASN A 115 ? ? 75.44 107.20 26 1 ASN A 127 ? ? -15.71 131.48 27 1 SER A 131 ? ? 177.66 -38.66 28 1 PHE A 154 ? ? -167.85 -164.77 29 1 LYS A 156 ? ? -17.65 -98.10 30 1 ASP A 157 ? ? -76.57 46.26 31 1 ARG A 158 ? ? 62.92 98.49 32 1 SER A 167 ? ? -58.51 108.41 33 1 ASP A 182 ? ? -113.98 -162.02 34 1 HIS A 187 ? ? 68.27 -173.84 35 1 SER A 196 ? ? -94.77 -143.21 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 15 ? ? 0.239 'SIDE CHAIN' 2 1 ARG A 33 ? ? 0.088 'SIDE CHAIN' 3 1 ARG A 72 ? ? 0.204 'SIDE CHAIN' 4 1 ARG A 85 ? ? 0.316 'SIDE CHAIN' 5 1 ARG A 104 ? ? 0.310 'SIDE CHAIN' 6 1 ARG A 158 ? ? 0.214 'SIDE CHAIN' 7 1 ARG A 190 ? ? 0.151 'SIDE CHAIN' #