data_1QP2 # _entry.id 1QP2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1QP2 RCSB RCSB009131 WWPDB D_1000009131 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1QP3 _pdbx_database_related.details ;THIS ENTRY CONTAINS THE MINIMIZED AVERAGE STRUCTURE. 20 NMR STRUCTURES CAN BE FOUND IN PROTEIN DATA BANK ENTRY 1QP3 ; _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QP2 _pdbx_database_status.recvd_initial_deposition_date 1999-05-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mayer, K.L.' 1 'Shen, G.' 2 'Bryant, D.A.' 3 'Lecomte, J.T.J.' 4 'Falzone, C.J.' 5 # _citation.id primary _citation.title 'The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.' _citation.journal_abbrev Biochemistry _citation.journal_volume 38 _citation.page_first 13736 _citation.page_last 13746 _citation.year 1999 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10521281 _citation.pdbx_database_id_DOI 10.1021/bi9910373 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Mayer, K.L.' 1 primary 'Shen, G.' 2 primary 'Bryant, D.A.' 3 primary 'Lecomte, J.T.' 4 primary 'Falzone, C.J.' 5 # _cell.entry_id 1QP2 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QP2 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PROTEIN (PSAE PROTEIN)' _entity.formula_weight 7969.069 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation WILD-TYPE _entity.pdbx_fragment 'FULL LENGTH' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK _entity_poly.pdbx_seq_one_letter_code_can MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 GLN n 1 4 ARG n 1 5 GLY n 1 6 SER n 1 7 LYS n 1 8 VAL n 1 9 ARG n 1 10 ILE n 1 11 LEU n 1 12 ARG n 1 13 PRO n 1 14 GLU n 1 15 SER n 1 16 TYR n 1 17 TRP n 1 18 PHE n 1 19 GLN n 1 20 ASP n 1 21 VAL n 1 22 GLY n 1 23 THR n 1 24 VAL n 1 25 ALA n 1 26 SER n 1 27 VAL n 1 28 ASP n 1 29 GLN n 1 30 SER n 1 31 GLY n 1 32 ILE n 1 33 LYS n 1 34 TYR n 1 35 PRO n 1 36 VAL n 1 37 ILE n 1 38 VAL n 1 39 ARG n 1 40 PHE n 1 41 GLU n 1 42 LYS n 1 43 VAL n 1 44 ASN n 1 45 TYR n 1 46 SER n 1 47 GLY n 1 48 ILE n 1 49 ASN n 1 50 THR n 1 51 ASN n 1 52 ASN n 1 53 PHE n 1 54 ALA n 1 55 GLU n 1 56 ASP n 1 57 GLU n 1 58 LEU n 1 59 VAL n 1 60 GLU n 1 61 VAL n 1 62 GLU n 1 63 ALA n 1 64 PRO n 1 65 LYS n 1 66 ALA n 1 67 LYS n 1 68 PRO n 1 69 LYS n 1 70 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Nostoc _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'PCC 8009' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nostoc sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29413 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET3D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PSAE_NOSS8 _struct_ref.pdbx_db_accession Q9WWP1 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QP2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9WWP1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 77 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 3D_15N-separated_NOESY 3 1 1 3D_13C-separated_NOESY 4 1 1 'J-modulated HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'NO BUFFER OR ADDED SALT' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'NO BUFFER OR ADDED SALT' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AMX2 _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1QP2 _pdbx_nmr_refine.method ;distance geometry simulated annealing molecular dynamics ; _pdbx_nmr_refine.details ;966 distance restraints 73 dihedral angle restraints 54 distance retraints from hydrogen bonds ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1QP2 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1QP2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1QP2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.85 'structure calculation' Brunger 1 XWINNMR 2.0 collection Bruker 2 FELIX 95 processing MSI 3 X-PLOR 3.85 refinement Brunger 4 X-PLOR 3.85 'structure solution' Brunger 5 # _exptl.entry_id 1QP2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY.' # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1QP2 _struct.title 'SOLUTION STRUCTURE OF PHOTOSYSTEM I ACCESSORY PROTEIN E FROM THE CYANOBACTERIUM NOSTOC SP. STRAIN PCC 8009' _struct.pdbx_descriptor 'PSAE PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1QP2 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'MAINLY BETA, ROLL, PLECKSTRIN TOPOLOGY, SH3-LIKE, ELECTRON TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 54 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 56 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 61 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 63 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 50 ? PHE A 53 ? THR A 57 PHE A 60 A 2 VAL A 36 ? ARG A 39 ? VAL A 36 ARG A 39 A 3 VAL A 21 ? VAL A 27 ? VAL A 21 VAL A 27 A 4 LYS A 7 ? ILE A 10 ? LYS A 7 ILE A 10 A 5 LEU A 58 ? GLU A 60 ? LEU A 65 GLU A 67 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 53 ? N PHE A 60 O VAL A 36 ? O VAL A 36 A 2 3 N ARG A 39 ? N ARG A 39 O THR A 23 ? O THR A 23 A 3 4 N GLY A 22 ? N GLY A 22 O VAL A 8 ? O VAL A 8 A 4 5 N ARG A 9 ? N ARG A 9 O VAL A 59 ? O VAL A 66 # _database_PDB_matrix.entry_id 1QP2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QP2 _atom_sites.fract_transf_matrix[1][1] 1.00 _atom_sites.fract_transf_matrix[1][2] 0.00 _atom_sites.fract_transf_matrix[1][3] 0.00 _atom_sites.fract_transf_matrix[2][1] 0.00 _atom_sites.fract_transf_matrix[2][2] 1.00 _atom_sites.fract_transf_matrix[2][3] 0.00 _atom_sites.fract_transf_matrix[3][1] 0.00 _atom_sites.fract_transf_matrix[3][2] 0.00 _atom_sites.fract_transf_matrix[3][3] 1.00 _atom_sites.fract_transf_vector[1] 0.00 _atom_sites.fract_transf_vector[2] 0.00 _atom_sites.fract_transf_vector[3] 0.00 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ILE 48 55 55 ILE ILE A . n A 1 49 ASN 49 56 56 ASN ASN A . n A 1 50 THR 50 57 57 THR THR A . n A 1 51 ASN 51 58 58 ASN ASN A . n A 1 52 ASN 52 59 59 ASN ASN A . n A 1 53 PHE 53 60 60 PHE PHE A . n A 1 54 ALA 54 61 61 ALA ALA A . n A 1 55 GLU 55 62 62 GLU GLU A . n A 1 56 ASP 56 63 63 ASP ASP A . n A 1 57 GLU 57 64 64 GLU GLU A . n A 1 58 LEU 58 65 65 LEU LEU A . n A 1 59 VAL 59 66 66 VAL VAL A . n A 1 60 GLU 60 67 67 GLU GLU A . n A 1 61 VAL 61 68 68 VAL VAL A . n A 1 62 GLU 62 69 69 GLU GLU A . n A 1 63 ALA 63 70 70 ALA ALA A . n A 1 64 PRO 64 71 71 PRO PRO A . n A 1 65 LYS 65 72 72 LYS LYS A . n A 1 66 ALA 66 73 73 ALA ALA A . n A 1 67 LYS 67 74 74 LYS LYS A . n A 1 68 PRO 68 75 75 PRO PRO A . n A 1 69 LYS 69 76 76 LYS LYS A . n A 1 70 LYS 70 77 77 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-10-20 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.851 ? 1 X-PLOR refinement 3.851 ? 2 X-PLOR phasing 3.851 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 17 ? ? -95.45 37.04 2 1 SER A 30 ? ? -144.42 -45.24 3 1 ALA A 73 ? ? -90.03 50.16 4 1 LYS A 74 ? ? -168.02 81.44 #