data_1QQ3 # _entry.id 1QQ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1QQ3 pdb_00001qq3 10.2210/pdb1qq3/pdb RCSB RCSB009166 ? ? WWPDB D_1000009166 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1QPU _pdbx_database_related.details '1QPU CONTAINS THE SOLUTION STRUCTURE OF WILD-TYPE OXIDIZED ESCHERICHIA COLI CYTOCHROME B562' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QQ3 _pdbx_database_status.recvd_initial_deposition_date 1999-06-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Arnesano, F.' 1 'Banci, L.' 2 'Bertini, I.' 3 'Ciofi-Baffoni, S.' 4 'Barker, P.D.' 5 'Woodyear, T.' 6 # _citation.id primary _citation.title 'Structural consequences of b- to c-type heme conversion in oxidized Escherichia coli cytochrome b562.' _citation.journal_abbrev Biochemistry _citation.journal_volume 39 _citation.page_first 1499 _citation.page_last 1514 _citation.year 2000 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10684632 _citation.pdbx_database_id_DOI 10.1021/bi991831o # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Arnesano, F.' 1 ? primary 'Banci, L.' 2 ? primary 'Bertini, I.' 3 ? primary 'Ciofi-Baffoni, S.' 4 ? primary 'Woodyear, T.L.' 5 ? primary 'Johnson, C.M.' 6 ? primary 'Barker, P.D.' 7 ? # _cell.entry_id 1QQ3 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QQ3 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME B562' 11745.190 1 ? R98C ? ? 2 non-polymer syn 'HEME B/C' 618.503 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN EGKVKEAQAAAEQLKTTCNAYHQKYR ; _entity_poly.pdbx_seq_one_letter_code_can ;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN EGKVKEAQAAAEQLKTTCNAYHQKYR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 LEU n 1 4 GLU n 1 5 ASP n 1 6 ASN n 1 7 MET n 1 8 GLU n 1 9 THR n 1 10 LEU n 1 11 ASN n 1 12 ASP n 1 13 ASN n 1 14 LEU n 1 15 LYS n 1 16 VAL n 1 17 ILE n 1 18 GLU n 1 19 LYS n 1 20 ALA n 1 21 ASP n 1 22 ASN n 1 23 ALA n 1 24 ALA n 1 25 GLN n 1 26 VAL n 1 27 LYS n 1 28 ASP n 1 29 ALA n 1 30 LEU n 1 31 THR n 1 32 LYS n 1 33 MET n 1 34 ARG n 1 35 ALA n 1 36 ALA n 1 37 ALA n 1 38 LEU n 1 39 ASP n 1 40 ALA n 1 41 GLN n 1 42 LYS n 1 43 ALA n 1 44 THR n 1 45 PRO n 1 46 PRO n 1 47 LYS n 1 48 LEU n 1 49 GLU n 1 50 ASP n 1 51 LYS n 1 52 SER n 1 53 PRO n 1 54 ASP n 1 55 SER n 1 56 PRO n 1 57 GLU n 1 58 MET n 1 59 LYS n 1 60 ASP n 1 61 PHE n 1 62 ARG n 1 63 HIS n 1 64 GLY n 1 65 PHE n 1 66 ASP n 1 67 ILE n 1 68 LEU n 1 69 VAL n 1 70 GLY n 1 71 GLN n 1 72 ILE n 1 73 ASP n 1 74 ASP n 1 75 ALA n 1 76 LEU n 1 77 LYS n 1 78 LEU n 1 79 ALA n 1 80 ASN n 1 81 GLU n 1 82 GLY n 1 83 LYS n 1 84 VAL n 1 85 LYS n 1 86 GLU n 1 87 ALA n 1 88 GLN n 1 89 ALA n 1 90 ALA n 1 91 ALA n 1 92 GLU n 1 93 GLN n 1 94 LEU n 1 95 LYS n 1 96 THR n 1 97 THR n 1 98 CYS n 1 99 ASN n 1 100 ALA n 1 101 TYR n 1 102 HIS n 1 103 GLN n 1 104 LYS n 1 105 TYR n 1 106 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PCEB562 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C562_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0ABE7 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QQ3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0ABE7 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 106 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1QQ3 _struct_ref_seq_dif.mon_id CYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 98 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P0ABE7 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 120 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 98 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEB non-polymer . 'HEME B/C' 'HYBRID BETWEEN B AND C TYPE HEMES (PROTOPORPHYRIN IX CONTAINING FE)' 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 2 3D_15N-SEPARATED_NOESY 2 3 2 HNHA 2 4 1 '1D NOE' 1 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 AMBIENT 4.8 '500mM PHOSPHATE' ? K 2 298 AMBIENT 4.8 '500mM PHOSPHATE' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '3MM R98C CYTOCHROME B562; 500MM PHOSPHATE BUFFER; 90% H2O, 10% D2O' ? 2 '2.5MM R98C CYTOCHROME B562; 500MM PHOSPHATE BUFFER; 90% H2O, 10% D2O' ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 800 ? 2 AVANCE Bruker 600 ? # _pdbx_nmr_refine.entry_id 1QQ3 _pdbx_nmr_refine.method 'TORSION ANGLE DYNAMICS FOLLOWED BY ENERGY MINIMIZATION' _pdbx_nmr_refine.details ;A TOTAL OF 4325 NOESY CROSS-PEAKS WAS ASSIGNED, INTEGRATED AND TRANSFORMED IN UPPER DISTANCE LIMITS; 23 DISTANCE CONSTRAINTS WERE DERIVED FROM 1D NOE EXPERIMENTS INVOLVING FAST RELAXING PARAMAGNETIC SHIFTED SIGNALS. TOTALLY, THEY CORRESPONDED TO 2595 UPPER DISTANCE LIMITS, OF WHICH 2145 WERE FOUND TO BE MEANINGFUL. IN ADDITION, 45 3JHNHA COUPLINGS OBTAINED FROM THE HNHA 3D SPECTRUM AND 397 PCS WERE USED FOR THE STRUCTURE CALCULATIONS. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1QQ3 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'ENERGY MINIMIZED AVERAGE STRUCTURE' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1QQ3 _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing XwinNMR ? ? 1 'structure solution' DYANA 1.5 'GUENTERT P., MUMENTHALER, C., & WUTHRICH, K.' 2 'data analysis' XEASY ? 'ECCLES, C., GUENTERT P., BILLETER, M., & WUTHRICH, K.' 3 'structure solution' PSEUDODYANA ? 'BANCI, L., BERTINI, I., CREMONINI, M.A., GORI SAVELLINI, G., LUCHINAT, C., WUTHRICH, K. & GUENTERT, P.' 4 refinement Amber 5.0 ;PEARLMAN, D.A., CASE, D.A., CALDWELL, J.W., ROSS, W.S., CHEATHAM, T.E., FERGUSON, D.M., SEIBEL, G.L., SINGH, U.C., WEINER, P.K., & KOLLMAN, P.A. ; 5 # _exptl.entry_id 1QQ3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1QQ3 _struct.title 'THE SOLUTION STRUCTURE OF THE HEME BINDING VARIANT ARG98CYS OF OXIDIZED ESCHERICHIA COLI CYTOCHROME B562' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1QQ3 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'FOUR HELIX BUNDLE, HEMOPROTEIN, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? LYS A 19 ? ASP A 2 LYS A 19 1 ? 18 HELX_P HELX_P2 2 ASN A 22 ? GLN A 41 ? ASN A 22 GLN A 41 1 ? 20 HELX_P HELX_P3 3 PRO A 45 ? GLU A 49 ? PRO A 45 GLU A 49 5 ? 5 HELX_P HELX_P4 4 GLU A 57 ? GLU A 81 ? GLU A 57 GLU A 81 1 ? 25 HELX_P HELX_P5 5 LYS A 83 ? GLN A 103 ? LYS A 83 GLN A 103 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 98 SG ? ? ? 1_555 B HEB . CAB ? ? A CYS 98 A HEB 107 1_555 ? ? ? ? ? ? ? 1.776 ? ? metalc1 metalc ? ? A MET 7 SD ? ? ? 1_555 B HEB . FE ? ? A MET 7 A HEB 107 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc2 metalc ? ? A HIS 102 NE2 ? ? ? 1_555 B HEB . FE ? ? A HIS 102 A HEB 107 1_555 ? ? ? ? ? ? ? 2.002 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEB _struct_site.pdbx_auth_seq_id 107 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'BINDING SITE FOR RESIDUE HEB A 107' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 MET A 7 ? MET A 7 . ? 1_555 ? 2 AC1 12 LEU A 14 ? LEU A 14 . ? 1_555 ? 3 AC1 12 PRO A 45 ? PRO A 45 . ? 1_555 ? 4 AC1 12 PRO A 46 ? PRO A 46 . ? 1_555 ? 5 AC1 12 PHE A 61 ? PHE A 61 . ? 1_555 ? 6 AC1 12 GLY A 64 ? GLY A 64 . ? 1_555 ? 7 AC1 12 PHE A 65 ? PHE A 65 . ? 1_555 ? 8 AC1 12 LEU A 68 ? LEU A 68 . ? 1_555 ? 9 AC1 12 CYS A 98 ? CYS A 98 . ? 1_555 ? 10 AC1 12 HIS A 102 ? HIS A 102 . ? 1_555 ? 11 AC1 12 TYR A 105 ? TYR A 105 . ? 1_555 ? 12 AC1 12 ARG A 106 ? ARG A 106 . ? 1_555 ? # _database_PDB_matrix.entry_id 1QQ3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QQ3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 ARG 106 106 106 ARG ARG A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEB _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 107 _pdbx_nonpoly_scheme.auth_seq_num 107 _pdbx_nonpoly_scheme.pdb_mon_id HEB _pdbx_nonpoly_scheme.auth_mon_id HEM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SD ? A MET 7 ? A MET 7 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NA ? B HEB . ? A HEB 107 ? 1_555 84.0 ? 2 SD ? A MET 7 ? A MET 7 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NB ? B HEB . ? A HEB 107 ? 1_555 98.6 ? 3 NA ? B HEB . ? A HEB 107 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NB ? B HEB . ? A HEB 107 ? 1_555 90.1 ? 4 SD ? A MET 7 ? A MET 7 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NC ? B HEB . ? A HEB 107 ? 1_555 95.4 ? 5 NA ? B HEB . ? A HEB 107 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NC ? B HEB . ? A HEB 107 ? 1_555 177.6 ? 6 NB ? B HEB . ? A HEB 107 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NC ? B HEB . ? A HEB 107 ? 1_555 92.3 ? 7 SD ? A MET 7 ? A MET 7 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 ND ? B HEB . ? A HEB 107 ? 1_555 81.2 ? 8 NA ? B HEB . ? A HEB 107 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 ND ? B HEB . ? A HEB 107 ? 1_555 90.6 ? 9 NB ? B HEB . ? A HEB 107 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 ND ? B HEB . ? A HEB 107 ? 1_555 179.2 ? 10 NC ? B HEB . ? A HEB 107 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 ND ? B HEB . ? A HEB 107 ? 1_555 87.0 ? 11 SD ? A MET 7 ? A MET 7 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 171.3 ? 12 NA ? B HEB . ? A HEB 107 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 87.5 ? 13 NB ? B HEB . ? A HEB 107 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 82.9 ? 14 NC ? B HEB . ? A HEB 107 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 93.1 ? 15 ND ? B HEB . ? A HEB 107 ? 1_555 FE ? B HEB . ? A HEB 107 ? 1_555 NE2 ? A HIS 102 ? A HIS 102 ? 1_555 97.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-05-24 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_ref_seq_dif.details' 31 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB1 A ALA 1 ? ? OD2 A ASP 39 ? ? 1.57 2 1 CB A ALA 1 ? ? OD2 A ASP 39 ? ? 1.99 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CA _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 ALA _pdbx_validate_rmsd_bond.auth_seq_id_1 1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CB _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ALA _pdbx_validate_rmsd_bond.auth_seq_id_2 1 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.084 _pdbx_validate_rmsd_bond.bond_target_value 1.520 _pdbx_validate_rmsd_bond.bond_deviation -0.436 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.021 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 21 ? ? -132.59 -39.58 2 1 PRO A 56 ? ? -75.18 20.71 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME B/C' _pdbx_entity_nonpoly.comp_id HEB #