data_1QTU # _entry.id 1QTU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1QTU RCSB RCSB009259 WWPDB D_1000009259 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1A1X _pdbx_database_related.details '1A1X contains the RX structure of p13MTCP1' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QTU _pdbx_database_status.recvd_initial_deposition_date 1999-06-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Guignard, L.' 1 'Padilla, A.' 2 'Mispelter, J.' 3 'Yang, Y.-S.' 4 'Stern, M.-H.' 5 'Lhoste, J.-M.' 6 'Roumestand, C.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Backbone dynamics and solution structure refinement of the 15N-labeled human oncogenic protein p13MTCP1: comparison with X-ray data. ; J.Biomol.NMR 17 215 230 2000 JBNME9 NE 0925-2738 0800 ? 10959629 10.1023/A:1008386110930 1 'Solution structure of the recombinant human oncoprotein p13MTCP1' J.Biomol.NMR 11 337 354 1998 JBNME9 NE 0925-2738 0800 ? ? 10.1023/A:1008279616063 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Guignard, L.' 1 primary 'Padilla, A.' 2 primary 'Mispelter, J.' 3 primary 'Yang, Y.S.' 4 primary 'Stern, M.H.' 5 primary 'Lhoste, J.M.' 6 primary 'Roumestand, C.' 7 1 'Yang, Y.-S.' 8 1 'Guignard, L.' 9 1 'Padilla, A.' 10 1 'Hoh, F.' 11 1 'Strub, M.-P.' 12 # _cell.entry_id 1QTU _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QTU _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PROTEIN (PRODUCT OF THE MTCP1 ONCOGENE)' _entity.formula_weight 13680.420 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYM DNNSRLWQIQHHLMVRGVQELLLKLLPDDRSPGIHRD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYM DNNSRLWQIQHHLMVRGVQELLLKLLPDDRSPGIHRD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 ALA n 1 5 GLY n 1 6 GLU n 1 7 ASP n 1 8 VAL n 1 9 GLY n 1 10 ALA n 1 11 PRO n 1 12 PRO n 1 13 ASP n 1 14 HIS n 1 15 LEU n 1 16 TRP n 1 17 VAL n 1 18 HIS n 1 19 GLN n 1 20 GLU n 1 21 GLY n 1 22 ILE n 1 23 TYR n 1 24 ARG n 1 25 ASP n 1 26 GLU n 1 27 TYR n 1 28 GLN n 1 29 ARG n 1 30 THR n 1 31 TRP n 1 32 VAL n 1 33 ALA n 1 34 VAL n 1 35 VAL n 1 36 GLU n 1 37 GLU n 1 38 GLU n 1 39 THR n 1 40 SER n 1 41 PHE n 1 42 LEU n 1 43 ARG n 1 44 ALA n 1 45 ARG n 1 46 VAL n 1 47 GLN n 1 48 GLN n 1 49 ILE n 1 50 GLN n 1 51 VAL n 1 52 PRO n 1 53 LEU n 1 54 GLY n 1 55 ASP n 1 56 ALA n 1 57 ALA n 1 58 ARG n 1 59 PRO n 1 60 SER n 1 61 HIS n 1 62 LEU n 1 63 LEU n 1 64 THR n 1 65 SER n 1 66 GLN n 1 67 LEU n 1 68 PRO n 1 69 LEU n 1 70 MET n 1 71 TRP n 1 72 GLN n 1 73 LEU n 1 74 TYR n 1 75 PRO n 1 76 GLU n 1 77 GLU n 1 78 ARG n 1 79 TYR n 1 80 MET n 1 81 ASP n 1 82 ASN n 1 83 ASN n 1 84 SER n 1 85 ARG n 1 86 LEU n 1 87 TRP n 1 88 GLN n 1 89 ILE n 1 90 GLN n 1 91 HIS n 1 92 HIS n 1 93 LEU n 1 94 MET n 1 95 VAL n 1 96 ARG n 1 97 GLY n 1 98 VAL n 1 99 GLN n 1 100 GLU n 1 101 LEU n 1 102 LEU n 1 103 LEU n 1 104 LYS n 1 105 LEU n 1 106 LEU n 1 107 PRO n 1 108 ASP n 1 109 ASP n 1 110 ARG n 1 111 SER n 1 112 PRO n 1 113 GLY n 1 114 ILE n 1 115 HIS n 1 116 ARG n 1 117 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell T-CELLS _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell BL21 _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PGEX-2T _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MTCPB_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P56278 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QTU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 117 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56278 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 117 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 117 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 '2D NOESY' 3 1 1 DQF-COSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM p13MTCP1 U-15N; 20mM phosphate buffer NA;90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AMX 600 2 ? Bruker DMX 800 3 ? Bruker AMX 400 # _pdbx_nmr_refine.entry_id 1QTU _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'the structures are based on a total of 1773 NOE restraints, 80 dihedral angle restraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1QTU _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1QTU _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_software.name AMBER _pdbx_nmr_software.version 4.1 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors 'Kollman. P-A.' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1QTU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1QTU _struct.title 'SOLUTION STRUCTURE OF THE ONCOPROTEIN P13MTCP1' _struct.pdbx_descriptor 'PROTEIN (PRODUCT OF THE MTCP1 ONCOGENE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1QTU _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text 'BETA BARREL, GENE REGULATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 65 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 58 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 65 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 14 ? GLN A 19 ? HIS A 14 GLN A 19 A 2 ILE A 22 ? ARG A 24 ? ILE A 22 ARG A 24 A 3 THR A 30 ? GLU A 38 ? THR A 30 GLU A 38 A 4 PHE A 41 ? GLN A 48 ? PHE A 41 GLN A 48 A 5 VAL A 98 ? LEU A 105 ? VAL A 98 LEU A 105 A 6 LEU A 86 ? VAL A 95 ? LEU A 86 VAL A 95 A 7 ARG A 78 ? ASP A 81 ? ARG A 78 ASP A 81 A 8 MET A 70 ? TYR A 74 ? MET A 70 TYR A 74 A 9 HIS A 14 ? GLN A 19 ? HIS A 14 GLN A 19 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 19 ? O GLN A 19 N ILE A 22 ? N ILE A 22 A 2 3 N TYR A 23 ? N TYR A 23 O TRP A 31 ? O TRP A 31 A 3 4 N GLU A 38 ? N GLU A 38 O PHE A 41 ? O PHE A 41 A 4 5 N GLN A 48 ? N GLN A 48 O GLN A 99 ? O GLN A 99 A 5 6 O LYS A 104 ? O LYS A 104 N GLN A 88 ? N GLN A 88 A 6 7 N TRP A 87 ? N TRP A 87 O TYR A 79 ? O TYR A 79 A 7 8 O MET A 80 ? O MET A 80 N GLN A 72 ? N GLN A 72 A 8 9 N TRP A 71 ? N TRP A 71 O LEU A 15 ? O LEU A 15 # _database_PDB_matrix.entry_id 1QTU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QTU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 ARG 116 116 ? ? ? A . n A 1 117 ASP 117 117 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-01-19 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' citation_author 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.name' 2 4 'Structure model' '_citation_author.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A SER 60 ? ? HG1 A THR 64 ? ? 1.52 2 1 O A LEU 62 ? ? HG A SER 65 ? ? 1.52 3 1 HG A SER 111 ? ? O A ILE 114 ? ? 1.52 4 1 HG A SER 2 ? ? O A HIS 92 ? ? 1.53 5 1 O A PRO 12 ? ? HH A TYR 79 ? ? 1.57 6 1 HH A TYR 23 ? ? O A PRO 68 ? ? 1.59 7 1 O A THR 39 ? ? HG A SER 40 ? ? 1.59 8 1 HG1 A THR 30 ? ? O A ILE 49 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 18 ? ? -137.71 -31.89 2 1 GLU A 20 ? ? -63.69 99.79 3 1 SER A 40 ? ? -152.85 27.83 4 1 ALA A 57 ? ? 59.29 -7.67 5 1 THR A 64 ? ? -64.85 -72.60 6 1 SER A 65 ? ? 45.43 27.30 7 1 GLN A 66 ? ? -65.72 -72.59 8 1 GLU A 77 ? ? 56.29 71.81 9 1 PRO A 107 ? ? -38.22 117.14 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 43 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.088 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 116 ? A ARG 116 2 1 Y 1 A ASP 117 ? A ASP 117 #