data_1QWQ # _entry.id 1QWQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1QWQ pdb_00001qwq 10.2210/pdb1qwq/pdb RCSB RCSB020160 ? ? WWPDB D_1000020160 ? ? BMRB 4980 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2003-09-16 _pdbx_database_PDB_obs_spr.pdb_id 1QWQ _pdbx_database_PDB_obs_spr.replace_pdb_id 1O0G _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 4980 '1H AND 15N SEQUENTIAL ASSIGNMENT AND SECONDARY STRUCTURE OF THE SAME PROTEIN' unspecified PDB 1BSR 'X-RAY STRUCTURE OF BOVINE SEMINAL RIBONUCLEASE' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QWQ _pdbx_database_status.recvd_initial_deposition_date 2003-09-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Avitabile, F.' 1 'Alfano, C.' 2 'Spadaccini, R.' 3 'Crescenzi, O.' 4 ;D'Ursi, A.M. ; 5 ;D'Alessio, G. ; 6 'Tancredi, T.' 7 'Picone, D.' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;THE SWAPPING OF TERMINAL ARMS IN RIBONUCLEASES: COMPARISON OF THE SOLUTION STRUCTURE OF MONOMERIC BOVINE SEMINAL AND PANCREATIC RIBONUCLEASES ; Biochemistry 42 8704 8711 2003 BICHAW US 0006-2960 0033 ? 12873130 10.1021/bi0342517 1 '1H and 15N sequential assignment and secondary structure of the monomeric N67D mutant of bovine seminal ribonuclease.' J.BIOMOL.NMR 20 289 290 2001 JBNME9 NE 0925-2738 0800 ? ? 10.1023/A:1011294812364 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Avitabile, F.' 1 ? primary 'Alfano, C.' 2 ? primary 'Spadaccini, R.' 3 ? primary 'Crescenzi, O.' 4 ? primary ;D'Ursi, A.M. ; 5 ? primary ;D'Alessio, G. ; 6 ? primary 'Tancredi, T.' 7 ? primary 'Picone, D.' 8 ? 1 'Crescenzi, O.' 9 ? 1 'Carotenuto, A.' 10 ? 1 ;D'Ursi, A.M. ; 11 ? 1 'Tancredi, T.' 12 ? 1 ;D'Alessio, G. ; 13 ? 1 'Avitabile, F.' 14 ? 1 'Picone, D.' 15 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Ribonuclease _entity.formula_weight 13633.624 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.27.5 _entity.pdbx_mutation N67D _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Seminal Ribonuclease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKDGQTNCYQSKSTMR ITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHFDASV ; _entity_poly.pdbx_seq_one_letter_code_can ;KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKDGQTNCYQSKSTMR ITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHFDASV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLU n 1 3 SER n 1 4 ALA n 1 5 ALA n 1 6 ALA n 1 7 LYS n 1 8 PHE n 1 9 GLU n 1 10 ARG n 1 11 GLN n 1 12 HIS n 1 13 MET n 1 14 ASP n 1 15 SER n 1 16 GLY n 1 17 ASN n 1 18 SER n 1 19 PRO n 1 20 SER n 1 21 SER n 1 22 SER n 1 23 SER n 1 24 ASN n 1 25 TYR n 1 26 CYS n 1 27 ASN n 1 28 LEU n 1 29 MET n 1 30 MET n 1 31 CYS n 1 32 CYS n 1 33 ARG n 1 34 LYS n 1 35 MET n 1 36 THR n 1 37 GLN n 1 38 GLY n 1 39 LYS n 1 40 CYS n 1 41 LYS n 1 42 PRO n 1 43 VAL n 1 44 ASN n 1 45 THR n 1 46 PHE n 1 47 VAL n 1 48 HIS n 1 49 GLU n 1 50 SER n 1 51 LEU n 1 52 ALA n 1 53 ASP n 1 54 VAL n 1 55 LYS n 1 56 ALA n 1 57 VAL n 1 58 CYS n 1 59 SER n 1 60 GLN n 1 61 LYS n 1 62 LYS n 1 63 VAL n 1 64 THR n 1 65 CYS n 1 66 LYS n 1 67 ASP n 1 68 GLY n 1 69 GLN n 1 70 THR n 1 71 ASN n 1 72 CYS n 1 73 TYR n 1 74 GLN n 1 75 SER n 1 76 LYS n 1 77 SER n 1 78 THR n 1 79 MET n 1 80 ARG n 1 81 ILE n 1 82 THR n 1 83 ASP n 1 84 CYS n 1 85 ARG n 1 86 GLU n 1 87 THR n 1 88 GLY n 1 89 SER n 1 90 SER n 1 91 LYS n 1 92 TYR n 1 93 PRO n 1 94 ASN n 1 95 CYS n 1 96 ALA n 1 97 TYR n 1 98 LYS n 1 99 THR n 1 100 THR n 1 101 GLN n 1 102 VAL n 1 103 GLU n 1 104 LYS n 1 105 HIS n 1 106 ILE n 1 107 ILE n 1 108 VAL n 1 109 ALA n 1 110 CYS n 1 111 GLY n 1 112 GLY n 1 113 LYS n 1 114 PRO n 1 115 SER n 1 116 VAL n 1 117 PRO n 1 118 VAL n 1 119 HIS n 1 120 PHE n 1 121 ASP n 1 122 ALA n 1 123 SER n 1 124 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene SRN _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-22B+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNS_BOVIN _struct_ref.pdbx_db_accession P00669 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMR ITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHFDASV ; _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QWQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00669 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1QWQ _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 67 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00669 _struct_ref_seq_dif.db_mon_id ASN _struct_ref_seq_dif.pdbx_seq_db_seq_num 93 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 67 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_15N-separated_TOCSY 3 1 1 HNHA 4 1 1 HNHB 5 2 1 '2D NOESY' 6 2 1 '2D TOCSY' 7 2 1 '2D COSY' 8 2 1 '2D NHSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.65 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2.0MM MONOMERIC BOVINE SEMINAL RIBONUCLEASE U-97% 15N' '95% H2O/5% D2O' 2 '2.0MM MONOMERIC BOVINE SEMINAL RIBONUCLEASE' '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 500 2 ? Bruker DRX 600 3 ? Bruker DRX 400 # _pdbx_nmr_refine.entry_id 1QWQ _pdbx_nmr_refine.method 'TORSION ANGLE DYNAMICS, ENERGY MINIMIZATION' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1QWQ _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 16 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1QWQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe ? processing ? 1 NMRView 4.0.3 'data analysis' ? 2 DYANA 1.5 'structure solution' ? 3 Amber 6.0 refinement ? 4 # _exptl.entry_id 1QWQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1QWQ _struct.title 'Solution structure of the monomeric N67D mutant of Bovine Seminal Ribonuclease' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QWQ _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'ALPHA-BETA-PROTEIN, Hydrolase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 4 ? HIS A 12 ? ALA A 4 HIS A 12 1 ? 9 HELX_P HELX_P2 2 SER A 21 ? LYS A 34 ? SER A 21 LYS A 34 1 ? 14 HELX_P HELX_P3 3 SER A 50 ? SER A 59 ? SER A 50 SER A 59 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 84 SG ? ? A CYS 26 A CYS 84 1_555 ? ? ? ? ? ? ? 2.069 ? ? disulf2 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 95 SG ? ? A CYS 40 A CYS 95 1_555 ? ? ? ? ? ? ? 2.070 ? ? disulf3 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 58 A CYS 110 1_555 ? ? ? ? ? ? ? 2.081 ? ? disulf4 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 65 A CYS 72 1_555 ? ? ? ? ? ? ? 2.080 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 1 6.63 2 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 1 -2.22 3 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 2 7.49 4 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 2 4.19 5 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 3 10.14 6 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 3 3.98 7 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 4 5.85 8 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 4 4.96 9 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 5 8.09 10 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 5 -2.21 11 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 6 3.89 12 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 6 -7.28 13 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 7 6.66 14 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 7 3.44 15 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 8 10.00 16 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 8 2.46 17 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 9 7.61 18 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 9 -4.82 19 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 10 2.80 20 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 10 3.82 21 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 11 8.29 22 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 11 5.08 23 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 12 5.15 24 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 12 -2.47 25 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 13 7.63 26 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 13 -3.33 27 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 14 5.62 28 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 14 -1.58 29 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 15 -0.97 30 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 15 -3.55 31 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 16 1.35 32 LYS 113 A . ? LYS 113 A PRO 114 A ? PRO 114 A 16 -4.42 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 43 ? VAL A 47 ? VAL A 43 VAL A 47 A 2 MET A 79 ? ARG A 85 ? MET A 79 ARG A 85 A 3 LYS A 98 ? GLY A 111 ? LYS A 98 GLY A 111 A 4 ASN A 71 ? GLN A 74 ? ASN A 71 GLN A 74 A 5 LYS A 61 ? THR A 64 ? LYS A 61 THR A 64 B 1 VAL A 43 ? VAL A 47 ? VAL A 43 VAL A 47 B 2 MET A 79 ? ARG A 85 ? MET A 79 ARG A 85 B 3 LYS A 98 ? GLY A 111 ? LYS A 98 GLY A 111 B 4 VAL A 116 ? VAL A 124 ? VAL A 116 VAL A 124 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASN A 44 ? N ASN A 44 O CYS A 84 ? O CYS A 84 A 2 3 N ARG A 85 ? N ARG A 85 O LYS A 98 ? O LYS A 98 A 3 4 O VAL A 108 ? O VAL A 108 N TYR A 73 ? N TYR A 73 A 4 5 O CYS A 72 ? O CYS A 72 N VAL A 63 ? N VAL A 63 B 1 2 N ASN A 44 ? N ASN A 44 O CYS A 84 ? O CYS A 84 B 2 3 N ARG A 85 ? N ARG A 85 O LYS A 98 ? O LYS A 98 B 3 4 N ILE A 107 ? N ILE A 107 O ALA A 122 ? O ALA A 122 # _database_PDB_matrix.entry_id 1QWQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QWQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 VAL 124 124 124 VAL VAL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-09-16 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-26 5 'Structure model' 1 4 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' database_2 7 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 5 CA A CYS 65 ? ? CB A CYS 65 ? ? SG A CYS 65 ? ? 122.25 114.20 8.05 1.10 N 2 9 CA A CYS 40 ? ? CB A CYS 40 ? ? SG A CYS 40 ? ? 121.33 114.20 7.13 1.10 N 3 11 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH2 A ARG 33 ? ? 117.09 120.30 -3.21 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -123.27 -165.70 2 1 ALA A 4 ? ? 62.10 -74.93 3 1 HIS A 12 ? ? -131.50 -51.95 4 1 THR A 45 ? ? -102.36 62.31 5 1 HIS A 48 ? ? -90.41 59.39 6 1 GLN A 60 ? ? -94.72 -110.15 7 1 ASP A 67 ? ? -150.95 -44.36 8 1 GLN A 69 ? ? -154.39 -61.03 9 1 GLU A 86 ? ? -64.03 84.15 10 1 LYS A 91 ? ? -151.32 89.39 11 1 TYR A 92 ? ? -34.09 125.05 12 1 ALA A 122 ? ? -172.96 -170.06 13 2 ALA A 4 ? ? -175.23 -67.22 14 2 SER A 15 ? ? -69.93 71.26 15 2 SER A 22 ? ? -89.28 -114.30 16 2 LYS A 39 ? ? -86.29 -151.72 17 2 HIS A 48 ? ? -82.52 -117.49 18 2 GLU A 49 ? ? 58.17 -148.95 19 2 SER A 59 ? ? -109.22 48.41 20 2 GLN A 60 ? ? -114.76 -126.74 21 2 GLN A 69 ? ? -153.22 -69.27 22 2 GLU A 86 ? ? -43.61 108.47 23 2 SER A 89 ? ? -179.87 -48.23 24 2 SER A 90 ? ? -25.41 109.82 25 2 LYS A 113 ? ? -34.39 124.39 26 3 SER A 3 ? ? -144.75 36.98 27 3 ALA A 4 ? ? 66.75 -61.92 28 3 ASP A 14 ? ? -169.07 119.57 29 3 ASN A 17 ? ? 66.80 150.90 30 3 SER A 18 ? ? 75.20 141.21 31 3 SER A 21 ? ? -66.77 68.79 32 3 PRO A 42 ? ? -64.44 -71.40 33 3 PHE A 46 ? ? -65.48 98.97 34 3 ASP A 67 ? ? -146.99 -27.10 35 3 GLN A 69 ? ? -159.73 -73.09 36 3 SER A 75 ? ? -69.27 30.31 37 3 LYS A 76 ? ? 61.75 -28.64 38 3 GLU A 86 ? ? -68.42 74.48 39 3 SER A 89 ? ? -164.09 27.65 40 3 LYS A 91 ? ? -151.95 80.06 41 3 TYR A 92 ? ? -36.59 126.90 42 3 LYS A 113 ? ? -34.36 123.63 43 4 GLU A 2 ? ? -48.81 150.28 44 4 ALA A 4 ? ? 71.25 -73.13 45 4 SER A 15 ? ? -68.63 65.30 46 4 SER A 18 ? ? 69.73 140.94 47 4 SER A 20 ? ? -78.76 -90.98 48 4 SER A 22 ? ? -97.65 -74.97 49 4 HIS A 48 ? ? -82.34 -111.92 50 4 GLU A 49 ? ? 61.30 -154.93 51 4 GLN A 60 ? ? -117.50 -123.34 52 4 ASP A 67 ? ? -144.75 53.34 53 4 GLN A 69 ? ? -161.97 -58.24 54 4 SER A 89 ? ? 179.83 -36.35 55 4 LYS A 113 ? ? -34.40 123.50 56 4 VAL A 118 ? ? -141.98 -23.02 57 5 SER A 20 ? ? 74.25 157.75 58 5 THR A 36 ? ? -83.12 40.12 59 5 ASN A 44 ? ? -159.71 76.82 60 5 GLU A 49 ? ? -108.81 -143.28 61 5 THR A 70 ? ? 43.22 73.28 62 5 ASN A 71 ? ? -167.96 44.92 63 5 SER A 89 ? ? 177.93 -13.51 64 5 TYR A 92 ? ? -39.07 127.76 65 5 LYS A 104 ? ? -179.42 -173.55 66 5 VAL A 118 ? ? -147.76 -24.95 67 5 ALA A 122 ? ? -173.57 -177.51 68 6 ALA A 4 ? ? 69.02 -56.05 69 6 SER A 20 ? ? -45.29 -78.34 70 6 SER A 21 ? ? -156.22 -130.83 71 6 SER A 22 ? ? -129.94 -73.67 72 6 GLN A 60 ? ? -96.93 -117.10 73 6 SER A 89 ? ? 168.40 -36.68 74 6 SER A 115 ? ? -171.88 -163.13 75 7 ALA A 4 ? ? 61.80 -75.41 76 7 ASP A 14 ? ? -160.03 62.06 77 7 SER A 15 ? ? 28.37 39.56 78 7 ASN A 17 ? ? -68.28 87.20 79 7 SER A 18 ? ? 73.60 171.63 80 7 SER A 20 ? ? -60.27 57.95 81 7 SER A 21 ? ? -170.49 34.41 82 7 SER A 22 ? ? -78.15 48.45 83 7 GLN A 60 ? ? -101.51 -67.11 84 7 GLN A 69 ? ? -129.19 -62.85 85 7 GLU A 86 ? ? -58.55 108.40 86 7 SER A 89 ? ? 174.58 -61.09 87 7 SER A 90 ? ? -5.61 103.67 88 7 LYS A 113 ? ? -34.45 122.80 89 7 VAL A 118 ? ? -145.26 -28.77 90 7 ALA A 122 ? ? -171.68 -176.61 91 8 GLU A 2 ? ? -33.43 122.17 92 8 ALA A 4 ? ? -171.57 -55.01 93 8 ASP A 14 ? ? -156.20 56.05 94 8 SER A 15 ? ? 28.06 69.28 95 8 SER A 21 ? ? -173.83 139.62 96 8 SER A 22 ? ? -138.43 -67.99 97 8 LYS A 34 ? ? 71.77 40.71 98 8 MET A 35 ? ? -94.04 30.45 99 8 GLN A 60 ? ? -88.34 -71.27 100 8 VAL A 63 ? ? -122.39 -131.98 101 8 THR A 70 ? ? -166.58 -157.45 102 8 CYS A 72 ? ? 64.32 155.00 103 8 GLU A 86 ? ? -61.56 72.53 104 8 LYS A 113 ? ? -39.70 127.29 105 8 SER A 115 ? ? -68.28 97.47 106 8 VAL A 118 ? ? -149.31 -14.57 107 8 ALA A 122 ? ? -171.48 -175.46 108 8 SER A 123 ? ? -122.63 -160.29 109 9 SER A 3 ? ? -142.47 57.62 110 9 ALA A 4 ? ? 71.55 -51.92 111 9 HIS A 12 ? ? -90.48 -80.14 112 9 PRO A 19 ? ? -70.75 -168.34 113 9 LYS A 41 ? ? 67.05 166.01 114 9 HIS A 48 ? ? -85.10 -122.45 115 9 GLU A 49 ? ? 60.04 -164.55 116 9 GLN A 60 ? ? -85.66 -72.41 117 9 ASP A 67 ? ? -153.79 -23.70 118 9 GLN A 69 ? ? -123.14 -56.14 119 9 ARG A 80 ? ? -68.72 86.35 120 9 GLU A 86 ? ? -65.40 61.70 121 9 THR A 87 ? ? -102.05 -149.04 122 9 SER A 89 ? ? -168.78 33.41 123 10 GLU A 2 ? ? -37.82 108.18 124 10 ALA A 4 ? ? -176.24 -71.02 125 10 HIS A 12 ? ? -137.30 -72.84 126 10 SER A 20 ? ? -89.30 -149.57 127 10 SER A 21 ? ? -58.57 82.34 128 10 SER A 22 ? ? -19.92 -66.36 129 10 GLN A 37 ? ? 48.71 21.09 130 10 LYS A 39 ? ? 58.99 -165.48 131 10 GLN A 60 ? ? -102.73 -74.80 132 10 ASP A 67 ? ? -163.15 -34.54 133 10 GLN A 69 ? ? -155.24 -67.60 134 11 SER A 3 ? ? -151.00 53.83 135 11 ALA A 4 ? ? 175.01 -59.34 136 11 SER A 15 ? ? 25.44 64.06 137 11 SER A 18 ? ? 75.88 134.97 138 11 SER A 20 ? ? -81.87 -159.90 139 11 SER A 22 ? ? -108.27 -69.65 140 11 HIS A 48 ? ? -101.27 69.59 141 11 GLN A 60 ? ? -106.73 -114.24 142 11 GLN A 69 ? ? -87.30 -113.66 143 11 THR A 70 ? ? -163.56 -168.48 144 11 SER A 90 ? ? -26.68 109.37 145 11 LYS A 113 ? ? -35.20 117.68 146 11 VAL A 118 ? ? -146.26 -18.15 147 12 ALA A 4 ? ? 59.81 -76.55 148 12 SER A 18 ? ? 155.16 -57.21 149 12 SER A 22 ? ? -75.33 -139.71 150 12 SER A 23 ? ? -22.87 -60.43 151 12 LYS A 34 ? ? 73.16 38.39 152 12 GLN A 37 ? ? -69.30 85.23 153 12 GLN A 60 ? ? -81.36 -94.57 154 12 LYS A 61 ? ? -163.25 108.13 155 12 ASP A 67 ? ? -149.55 -33.12 156 12 GLN A 69 ? ? -127.46 -52.95 157 12 SER A 89 ? ? 167.50 -34.76 158 12 LYS A 104 ? ? -177.52 -171.39 159 12 SER A 115 ? ? -60.41 98.71 160 12 VAL A 118 ? ? -154.71 -10.58 161 13 GLU A 2 ? ? -54.03 107.91 162 13 SER A 3 ? ? -109.58 48.39 163 13 ALA A 4 ? ? 70.56 -59.03 164 13 ASP A 14 ? ? -155.76 74.23 165 13 SER A 15 ? ? -67.31 99.33 166 13 SER A 20 ? ? -115.71 -117.41 167 13 SER A 21 ? ? 31.97 57.97 168 13 THR A 36 ? ? -108.84 56.50 169 13 GLN A 37 ? ? -113.39 -107.99 170 13 LYS A 61 ? ? -166.55 100.60 171 13 VAL A 63 ? ? -130.93 -129.10 172 13 GLN A 69 ? ? -120.78 -60.41 173 13 CYS A 72 ? ? 72.76 141.79 174 13 SER A 90 ? ? -44.30 101.76 175 13 LYS A 113 ? ? -34.03 127.01 176 13 VAL A 118 ? ? -153.81 -30.04 177 13 ASP A 121 ? ? -96.41 -67.50 178 13 ALA A 122 ? ? -160.59 -165.87 179 14 ALA A 4 ? ? 69.32 -75.06 180 14 SER A 20 ? ? 66.13 156.50 181 14 SER A 22 ? ? 78.32 159.61 182 14 SER A 23 ? ? -60.05 -70.48 183 14 LYS A 61 ? ? -162.51 119.17 184 14 ASP A 67 ? ? -147.18 -33.06 185 14 GLN A 69 ? ? -154.13 -65.35 186 14 LYS A 76 ? ? -75.90 24.16 187 14 ALA A 122 ? ? -176.41 -179.37 188 15 SER A 3 ? ? -153.04 58.90 189 15 ALA A 4 ? ? 26.54 -76.94 190 15 SER A 15 ? ? 39.54 -142.87 191 15 ASN A 17 ? ? -156.85 -155.21 192 15 LYS A 34 ? ? 70.34 32.95 193 15 LYS A 39 ? ? 66.37 -177.34 194 15 PRO A 42 ? ? -68.86 -84.94 195 15 GLN A 60 ? ? -92.55 -109.73 196 15 GLN A 69 ? ? -169.04 -47.81 197 15 THR A 70 ? ? -151.88 -159.35 198 15 LYS A 104 ? ? -177.92 -173.50 199 15 ALA A 122 ? ? -170.49 -170.19 200 16 SER A 3 ? ? -148.15 49.01 201 16 ALA A 4 ? ? 52.65 -72.88 202 16 SER A 15 ? ? -53.53 97.02 203 16 SER A 18 ? ? -171.95 136.62 204 16 SER A 21 ? ? -155.12 48.64 205 16 GLN A 37 ? ? 64.04 -74.55 206 16 LYS A 39 ? ? -158.85 -158.79 207 16 ASP A 67 ? ? -160.32 -39.73 208 16 GLN A 69 ? ? -143.55 -65.02 209 16 ARG A 80 ? ? -64.88 86.11 210 16 GLU A 86 ? ? -45.35 107.87 211 16 SER A 90 ? ? -42.38 106.57 212 16 SER A 115 ? ? -67.37 91.51 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 25 ? ? 0.062 'SIDE CHAIN' 2 1 PHE A 46 ? ? 0.092 'SIDE CHAIN' 3 1 TYR A 92 ? ? 0.113 'SIDE CHAIN' 4 2 ARG A 10 ? ? 0.183 'SIDE CHAIN' 5 4 TYR A 73 ? ? 0.087 'SIDE CHAIN' 6 4 TYR A 92 ? ? 0.148 'SIDE CHAIN' 7 4 TYR A 97 ? ? 0.074 'SIDE CHAIN' 8 5 TYR A 25 ? ? 0.102 'SIDE CHAIN' 9 6 TYR A 25 ? ? 0.148 'SIDE CHAIN' 10 6 TYR A 73 ? ? 0.084 'SIDE CHAIN' 11 7 TYR A 73 ? ? 0.065 'SIDE CHAIN' 12 7 TYR A 97 ? ? 0.086 'SIDE CHAIN' 13 8 TYR A 73 ? ? 0.063 'SIDE CHAIN' 14 8 TYR A 97 ? ? 0.170 'SIDE CHAIN' 15 9 TYR A 92 ? ? 0.073 'SIDE CHAIN' 16 9 TYR A 97 ? ? 0.125 'SIDE CHAIN' 17 10 TYR A 97 ? ? 0.207 'SIDE CHAIN' 18 11 TYR A 25 ? ? 0.079 'SIDE CHAIN' 19 11 PHE A 46 ? ? 0.085 'SIDE CHAIN' 20 11 TYR A 92 ? ? 0.106 'SIDE CHAIN' 21 11 TYR A 97 ? ? 0.070 'SIDE CHAIN' 22 12 ARG A 80 ? ? 0.080 'SIDE CHAIN' 23 13 TYR A 73 ? ? 0.098 'SIDE CHAIN' 24 13 TYR A 92 ? ? 0.075 'SIDE CHAIN' 25 13 TYR A 97 ? ? 0.081 'SIDE CHAIN' 26 15 TYR A 25 ? ? 0.169 'SIDE CHAIN' 27 16 TYR A 25 ? ? 0.153 'SIDE CHAIN' #