data_1R6G # _entry.id 1R6G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1R6G RCSB RCSB020494 WWPDB D_1000020494 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1R6G _pdbx_database_status.recvd_initial_deposition_date 2003-10-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hangeland, J.J.' 1 'Dejneka, T.' 2 'Friends, T.J.' 3 'Devasthale, P.' 4 'Mellstrom, K.' 5 'Sandberg, J.' 6 'Grynfarb, M.' 7 'Doweyko, A.M.' 8 'Sack, J.S.' 9 'Einspahr, H.' 10 'Farnegardh, M.' 11 'Husman, B.' 12 'Ljunggren, J.' 13 'Koehler, K.' 14 'Sheppard, C.' 15 'Malm, J.' 16 'Ryono, D.E.' 17 # _citation.id primary _citation.title 'Thyroid receptor ligands. Part 2: Thyromimetics with improved selectivity for the thyroid hormone receptor beta.' _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_volume 14 _citation.page_first 3549 _citation.page_last 3553 _citation.year 2004 _citation.journal_id_ASTM BMCLE8 _citation.country UK _citation.journal_id_ISSN 0960-894X _citation.journal_id_CSD 1127 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15177471 _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2004.04.032 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hangeland, J.J.' 1 primary 'Doweyko, A.M.' 2 primary 'Dejneka, T.' 3 primary 'Friends, T.J.' 4 primary 'Devasthale, P.' 5 primary 'Mellstrom, K.' 6 primary 'Sandberg, J.' 7 primary 'Grynfarb, M.' 8 primary 'Sack, J.S.' 9 primary 'Einspahr, H.' 10 primary 'Farnegardh, M.' 11 primary 'Husman, B.' 12 primary 'Ljunggren, J.' 13 primary 'Koehler, K.' 14 primary 'Sheppard, C.' 15 primary 'Malm, J.' 16 primary 'Ryono, D.E.' 17 # _cell.entry_id 1R6G _cell.length_a 68.556 _cell.length_b 68.556 _cell.length_c 129.170 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1R6G _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thyroid hormone receptor beta-1' 29272.922 1 ? ? 'ligand binding domain' ? 2 non-polymer syn '2-[3,5-DIBROMO-4-(4-HYDROXY-3-{HYDROXY[(2-PHENYLETHYL)AMINO]METHYL}PHENOXY)PHENYL]ETHANE-1,1-DIOL' 553.240 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ELQKSIGKKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITR VVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSS FNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHM KVECPTELFPPLFLEVFED ; _entity_poly.pdbx_seq_one_letter_code_can ;ELQKSIGKKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITR VVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSS FNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHM KVECPTELFPPLFLEVFED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 LEU n 1 3 GLN n 1 4 LYS n 1 5 SER n 1 6 ILE n 1 7 GLY n 1 8 LYS n 1 9 LYS n 1 10 PRO n 1 11 GLU n 1 12 PRO n 1 13 THR n 1 14 ASP n 1 15 GLU n 1 16 GLU n 1 17 TRP n 1 18 GLU n 1 19 LEU n 1 20 ILE n 1 21 LYS n 1 22 THR n 1 23 VAL n 1 24 THR n 1 25 GLU n 1 26 ALA n 1 27 HIS n 1 28 VAL n 1 29 ALA n 1 30 THR n 1 31 ASN n 1 32 ALA n 1 33 GLN n 1 34 GLY n 1 35 SER n 1 36 HIS n 1 37 TRP n 1 38 LYS n 1 39 GLN n 1 40 LYS n 1 41 ARG n 1 42 LYS n 1 43 PHE n 1 44 LEU n 1 45 PRO n 1 46 GLU n 1 47 ASP n 1 48 ILE n 1 49 GLY n 1 50 GLN n 1 51 ALA n 1 52 PRO n 1 53 ILE n 1 54 VAL n 1 55 ASN n 1 56 ALA n 1 57 PRO n 1 58 GLU n 1 59 GLY n 1 60 GLY n 1 61 LYS n 1 62 VAL n 1 63 ASP n 1 64 LEU n 1 65 GLU n 1 66 ALA n 1 67 PHE n 1 68 SER n 1 69 HIS n 1 70 PHE n 1 71 THR n 1 72 LYS n 1 73 ILE n 1 74 ILE n 1 75 THR n 1 76 PRO n 1 77 ALA n 1 78 ILE n 1 79 THR n 1 80 ARG n 1 81 VAL n 1 82 VAL n 1 83 ASP n 1 84 PHE n 1 85 ALA n 1 86 LYS n 1 87 LYS n 1 88 LEU n 1 89 PRO n 1 90 MET n 1 91 PHE n 1 92 CYS n 1 93 GLU n 1 94 LEU n 1 95 PRO n 1 96 CYS n 1 97 GLU n 1 98 ASP n 1 99 GLN n 1 100 ILE n 1 101 ILE n 1 102 LEU n 1 103 LEU n 1 104 LYS n 1 105 GLY n 1 106 CYS n 1 107 CYS n 1 108 MET n 1 109 GLU n 1 110 ILE n 1 111 MET n 1 112 SER n 1 113 LEU n 1 114 ARG n 1 115 ALA n 1 116 ALA n 1 117 VAL n 1 118 ARG n 1 119 TYR n 1 120 ASP n 1 121 PRO n 1 122 GLU n 1 123 SER n 1 124 GLU n 1 125 THR n 1 126 LEU n 1 127 THR n 1 128 LEU n 1 129 ASN n 1 130 GLY n 1 131 GLU n 1 132 MET n 1 133 ALA n 1 134 VAL n 1 135 THR n 1 136 ARG n 1 137 GLY n 1 138 GLN n 1 139 LEU n 1 140 LYS n 1 141 ASN n 1 142 GLY n 1 143 GLY n 1 144 LEU n 1 145 GLY n 1 146 VAL n 1 147 VAL n 1 148 SER n 1 149 ASP n 1 150 ALA n 1 151 ILE n 1 152 PHE n 1 153 ASP n 1 154 LEU n 1 155 GLY n 1 156 MET n 1 157 SER n 1 158 LEU n 1 159 SER n 1 160 SER n 1 161 PHE n 1 162 ASN n 1 163 LEU n 1 164 ASP n 1 165 ASP n 1 166 THR n 1 167 GLU n 1 168 VAL n 1 169 ALA n 1 170 LEU n 1 171 LEU n 1 172 GLN n 1 173 ALA n 1 174 VAL n 1 175 LEU n 1 176 LEU n 1 177 MET n 1 178 SER n 1 179 SER n 1 180 ASP n 1 181 ARG n 1 182 PRO n 1 183 GLY n 1 184 LEU n 1 185 ALA n 1 186 CYS n 1 187 VAL n 1 188 GLU n 1 189 ARG n 1 190 ILE n 1 191 GLU n 1 192 LYS n 1 193 TYR n 1 194 GLN n 1 195 ASP n 1 196 SER n 1 197 PHE n 1 198 LEU n 1 199 LEU n 1 200 ALA n 1 201 PHE n 1 202 GLU n 1 203 HIS n 1 204 TYR n 1 205 ILE n 1 206 ASN n 1 207 TYR n 1 208 ARG n 1 209 LYS n 1 210 HIS n 1 211 HIS n 1 212 VAL n 1 213 THR n 1 214 HIS n 1 215 PHE n 1 216 TRP n 1 217 PRO n 1 218 LYS n 1 219 LEU n 1 220 LEU n 1 221 MET n 1 222 LYS n 1 223 VAL n 1 224 THR n 1 225 ASP n 1 226 LEU n 1 227 ARG n 1 228 MET n 1 229 ILE n 1 230 GLY n 1 231 ALA n 1 232 CYS n 1 233 HIS n 1 234 ALA n 1 235 SER n 1 236 ARG n 1 237 PHE n 1 238 LEU n 1 239 HIS n 1 240 MET n 1 241 LYS n 1 242 VAL n 1 243 GLU n 1 244 CYS n 1 245 PRO n 1 246 THR n 1 247 GLU n 1 248 LEU n 1 249 PHE n 1 250 PRO n 1 251 PRO n 1 252 LEU n 1 253 PHE n 1 254 LEU n 1 255 GLU n 1 256 VAL n 1 257 PHE n 1 258 GLU n 1 259 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'THRB, NR1A2, ERBA2, THR1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THB1_HUMAN _struct_ref.pdbx_db_accession P10828 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITR VVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSS FNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHM KVECPTELFPPLFLEVFED ; _struct_ref.pdbx_align_begin 203 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1R6G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 259 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10828 _struct_ref_seq.db_align_beg 203 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 461 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 203 _struct_ref_seq.pdbx_auth_seq_align_end 461 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1R6G _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 8 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P10828 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 210 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 210 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 442 non-polymer . '2-[3,5-DIBROMO-4-(4-HYDROXY-3-{HYDROXY[(2-PHENYLETHYL)AMINO]METHYL}PHENOXY)PHENYL]ETHANE-1,1-DIOL' '[3,5-DIBROMO-4-(4-HYDROXY-3-PHENETHYLCARBAMOYL-PHENOXY)-PHENYL]-ACETIC ACID' 'C23 H23 Br2 N O5' 553.240 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1R6G _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 58.91 _exptl_crystal.description ? _exptl_crystal.density_Matthews 2.99 _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pdbx_details 'Sodium acetate, sodium cacodylate , pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1998-12-05 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator null _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8337 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE BW7B' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, Hamburg' _diffrn_source.pdbx_synchrotron_beamline BW7B _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.8337 # _reflns.entry_id 1R6G _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 3 _reflns.d_resolution_low 30 _reflns.number_all 6953 _reflns.number_obs 6953 _reflns.percent_possible_obs 93 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.07 _reflns_shell.percent_possible_all 50 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1R6G _refine.ls_number_reflns_obs 6632 _refine.ls_number_reflns_all 6632 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.0 _refine.ls_d_res_high 3.00 _refine.ls_percent_reflns_obs 93.14 _refine.ls_R_factor_obs 0.26502 _refine.ls_R_factor_all 0.26502 _refine.ls_R_factor_R_work 0.26081 _refine.ls_R_factor_R_free 0.34677 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.5 _refine.ls_number_reflns_R_free 315 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.927 _refine.correlation_coeff_Fo_to_Fc_free 0.888 _refine.B_iso_mean 71.972 _refine.aniso_B[1][1] 5.52 _refine.aniso_B[2][2] 5.52 _refine.aniso_B[3][3] -8.28 _refine.aniso_B[1][2] 2.76 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.582 _refine.overall_SU_ML 0.441 _refine.overall_SU_B 26.141 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1887 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1918 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 30.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.022 ? 1960 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 1809 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.533 1.987 ? 2651 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.041 3.000 ? 4208 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.425 5.000 ? 236 'X-RAY DIFFRACTION' ? r_chiral_restr 0.070 0.200 ? 301 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 2133 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.006 0.020 ? 396 'X-RAY DIFFRACTION' ? r_nbd_refined 0.217 0.200 ? 482 'X-RAY DIFFRACTION' ? r_nbd_other 0.214 0.200 ? 2080 'X-RAY DIFFRACTION' ? r_nbtor_other 0.091 0.200 ? 1143 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.106 0.200 ? 22 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.288 0.200 ? 6 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.228 0.200 ? 31 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.014 0.200 ? 1 'X-RAY DIFFRACTION' ? r_mcbond_it 0.321 1.500 ? 1195 'X-RAY DIFFRACTION' ? r_mcangle_it 0.613 2.000 ? 1933 'X-RAY DIFFRACTION' ? r_scbond_it 0.980 3.000 ? 765 'X-RAY DIFFRACTION' ? r_scangle_it 1.603 4.500 ? 718 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 3.000 _refine_ls_shell.d_res_low 3.078 _refine_ls_shell.number_reflns_R_work 257 _refine_ls_shell.R_factor_R_work 0.386 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.538 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 16 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1R6G _struct.title 'Crystal structure of the thyroid hormone receptor beta ligand binding domain in complex with a beta selective compound' _struct.pdbx_descriptor 'Thyroid hormone receptor beta-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1R6G _struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR RECEPTOR' _struct_keywords.text 'alpha helical, HORMONE-GROWTH FACTOR RECEPTOR COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 2 ? GLY A 7 ? LEU A 204 GLY A 209 1 ? 6 HELX_P HELX_P2 2 THR A 13 ? ASN A 31 ? THR A 215 ASN A 233 1 ? 19 HELX_P HELX_P3 3 ASP A 63 ? LYS A 72 ? ASP A 265 LYS A 274 1 ? 10 HELX_P HELX_P4 4 ILE A 73 ? LEU A 88 ? ILE A 275 LEU A 290 1 ? 16 HELX_P HELX_P5 5 LEU A 88 ? GLU A 93 ? LEU A 290 GLU A 295 1 ? 6 HELX_P HELX_P6 6 PRO A 95 ? VAL A 117 ? PRO A 297 VAL A 319 1 ? 23 HELX_P HELX_P7 7 THR A 135 ? GLY A 142 ? THR A 337 GLY A 344 1 ? 8 HELX_P HELX_P8 8 GLY A 145 ? ASN A 162 ? GLY A 347 ASN A 364 1 ? 18 HELX_P HELX_P9 9 ASP A 164 ? MET A 177 ? ASP A 366 MET A 379 1 ? 14 HELX_P HELX_P10 10 CYS A 186 ? LYS A 209 ? CYS A 388 LYS A 411 1 ? 24 HELX_P HELX_P11 11 HIS A 214 ? CYS A 244 ? HIS A 416 CYS A 446 1 ? 31 HELX_P HELX_P12 12 PRO A 245 ? PHE A 249 ? PRO A 447 PHE A 451 5 ? 5 HELX_P HELX_P13 13 PRO A 250 ? GLU A 258 ? PRO A 452 GLU A 460 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 42 ? PHE A 43 ? LYS A 244 PHE A 245 A 2 MET A 132 ? VAL A 134 ? MET A 334 VAL A 336 A 3 LEU A 126 ? LEU A 128 ? LEU A 328 LEU A 330 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 42 ? N LYS A 244 O ALA A 133 ? O ALA A 335 A 2 3 O MET A 132 ? O MET A 334 N LEU A 128 ? N LEU A 330 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'BINDING SITE FOR RESIDUE 442 A 500' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 PHE A 70 ? PHE A 272 . ? 1_555 ? 2 AC1 16 ILE A 74 ? ILE A 276 . ? 1_555 ? 3 AC1 16 ALA A 77 ? ALA A 279 . ? 1_555 ? 4 AC1 16 ARG A 80 ? ARG A 282 . ? 1_555 ? 5 AC1 16 MET A 111 ? MET A 313 . ? 1_555 ? 6 AC1 16 ARG A 118 ? ARG A 320 . ? 1_555 ? 7 AC1 16 LEU A 128 ? LEU A 330 . ? 1_555 ? 8 AC1 16 ASN A 129 ? ASN A 331 . ? 1_555 ? 9 AC1 16 GLY A 142 ? GLY A 344 . ? 1_555 ? 10 AC1 16 GLY A 143 ? GLY A 345 . ? 1_555 ? 11 AC1 16 LEU A 144 ? LEU A 346 . ? 1_555 ? 12 AC1 16 HIS A 233 ? HIS A 435 . ? 1_555 ? 13 AC1 16 ARG A 236 ? ARG A 438 . ? 1_555 ? 14 AC1 16 PHE A 237 ? PHE A 439 . ? 1_555 ? 15 AC1 16 MET A 240 ? MET A 442 . ? 1_555 ? 16 AC1 16 PHE A 253 ? PHE A 455 . ? 1_555 ? # _database_PDB_matrix.entry_id 1R6G _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1R6G _atom_sites.fract_transf_matrix[1][1] 0.014587 _atom_sites.fract_transf_matrix[1][2] 0.008422 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016843 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007742 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BR C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 203 203 GLU ALA A . n A 1 2 LEU 2 204 204 LEU LEU A . n A 1 3 GLN 3 205 205 GLN GLN A . n A 1 4 LYS 4 206 206 LYS ALA A . n A 1 5 SER 5 207 207 SER SER A . n A 1 6 ILE 6 208 208 ILE ILE A . n A 1 7 GLY 7 209 209 GLY GLY A . n A 1 8 LYS 8 210 210 LYS ALA A . n A 1 9 LYS 9 211 211 LYS LYS A . n A 1 10 PRO 10 212 212 PRO PRO A . n A 1 11 GLU 11 213 213 GLU GLU A . n A 1 12 PRO 12 214 214 PRO PRO A . n A 1 13 THR 13 215 215 THR THR A . n A 1 14 ASP 14 216 216 ASP ASP A . n A 1 15 GLU 15 217 217 GLU GLU A . n A 1 16 GLU 16 218 218 GLU GLU A . n A 1 17 TRP 17 219 219 TRP TRP A . n A 1 18 GLU 18 220 220 GLU GLU A . n A 1 19 LEU 19 221 221 LEU LEU A . n A 1 20 ILE 20 222 222 ILE ILE A . n A 1 21 LYS 21 223 223 LYS LYS A . n A 1 22 THR 22 224 224 THR THR A . n A 1 23 VAL 23 225 225 VAL VAL A . n A 1 24 THR 24 226 226 THR THR A . n A 1 25 GLU 25 227 227 GLU GLU A . n A 1 26 ALA 26 228 228 ALA ALA A . n A 1 27 HIS 27 229 229 HIS HIS A . n A 1 28 VAL 28 230 230 VAL VAL A . n A 1 29 ALA 29 231 231 ALA ALA A . n A 1 30 THR 30 232 232 THR THR A . n A 1 31 ASN 31 233 233 ASN ASN A . n A 1 32 ALA 32 234 234 ALA ALA A . n A 1 33 GLN 33 235 ? ? ? A . n A 1 34 GLY 34 236 ? ? ? A . n A 1 35 SER 35 237 ? ? ? A . n A 1 36 HIS 36 238 ? ? ? A . n A 1 37 TRP 37 239 ? ? ? A . n A 1 38 LYS 38 240 ? ? ? A . n A 1 39 GLN 39 241 ? ? ? A . n A 1 40 LYS 40 242 ? ? ? A . n A 1 41 ARG 41 243 243 ARG ARG A . n A 1 42 LYS 42 244 244 LYS LYS A . n A 1 43 PHE 43 245 245 PHE PHE A . n A 1 44 LEU 44 246 246 LEU LEU A . n A 1 45 PRO 45 247 247 PRO PRO A . n A 1 46 GLU 46 248 248 GLU GLU A . n A 1 47 ASP 47 249 249 ASP ASP A . n A 1 48 ILE 48 250 250 ILE ILE A . n A 1 49 GLY 49 251 251 GLY GLY A . n A 1 50 GLN 50 252 252 GLN GLN A . n A 1 51 ALA 51 253 ? ? ? A . n A 1 52 PRO 52 254 ? ? ? A . n A 1 53 ILE 53 255 ? ? ? A . n A 1 54 VAL 54 256 ? ? ? A . n A 1 55 ASN 55 257 ? ? ? A . n A 1 56 ALA 56 258 ? ? ? A . n A 1 57 PRO 57 259 ? ? ? A . n A 1 58 GLU 58 260 ? ? ? A . n A 1 59 GLY 59 261 ? ? ? A . n A 1 60 GLY 60 262 ? ? ? A . n A 1 61 LYS 61 263 ? ? ? A . n A 1 62 VAL 62 264 264 VAL VAL A . n A 1 63 ASP 63 265 265 ASP ASP A . n A 1 64 LEU 64 266 266 LEU LEU A . n A 1 65 GLU 65 267 267 GLU GLU A . n A 1 66 ALA 66 268 268 ALA ALA A . n A 1 67 PHE 67 269 269 PHE PHE A . n A 1 68 SER 68 270 270 SER SER A . n A 1 69 HIS 69 271 271 HIS HIS A . n A 1 70 PHE 70 272 272 PHE PHE A . n A 1 71 THR 71 273 273 THR THR A . n A 1 72 LYS 72 274 274 LYS LYS A . n A 1 73 ILE 73 275 275 ILE ILE A . n A 1 74 ILE 74 276 276 ILE ILE A . n A 1 75 THR 75 277 277 THR THR A . n A 1 76 PRO 76 278 278 PRO PRO A . n A 1 77 ALA 77 279 279 ALA ALA A . n A 1 78 ILE 78 280 280 ILE ILE A . n A 1 79 THR 79 281 281 THR THR A . n A 1 80 ARG 80 282 282 ARG ARG A . n A 1 81 VAL 81 283 283 VAL VAL A . n A 1 82 VAL 82 284 284 VAL VAL A . n A 1 83 ASP 83 285 285 ASP ASP A . n A 1 84 PHE 84 286 286 PHE PHE A . n A 1 85 ALA 85 287 287 ALA ALA A . n A 1 86 LYS 86 288 288 LYS LYS A . n A 1 87 LYS 87 289 289 LYS LYS A . n A 1 88 LEU 88 290 290 LEU LEU A . n A 1 89 PRO 89 291 291 PRO PRO A . n A 1 90 MET 90 292 292 MET MET A . n A 1 91 PHE 91 293 293 PHE PHE A . n A 1 92 CYS 92 294 294 CYS CYS A . n A 1 93 GLU 93 295 295 GLU GLU A . n A 1 94 LEU 94 296 296 LEU LEU A . n A 1 95 PRO 95 297 297 PRO PRO A . n A 1 96 CYS 96 298 298 CYS CYS A . n A 1 97 GLU 97 299 299 GLU GLU A . n A 1 98 ASP 98 300 300 ASP ASP A . n A 1 99 GLN 99 301 301 GLN GLN A . n A 1 100 ILE 100 302 302 ILE ILE A . n A 1 101 ILE 101 303 303 ILE ILE A . n A 1 102 LEU 102 304 304 LEU LEU A . n A 1 103 LEU 103 305 305 LEU LEU A . n A 1 104 LYS 104 306 306 LYS LYS A . n A 1 105 GLY 105 307 307 GLY GLY A . n A 1 106 CYS 106 308 308 CYS CYS A . n A 1 107 CYS 107 309 309 CYS CYS A . n A 1 108 MET 108 310 310 MET MET A . n A 1 109 GLU 109 311 311 GLU GLU A . n A 1 110 ILE 110 312 312 ILE ILE A . n A 1 111 MET 111 313 313 MET MET A . n A 1 112 SER 112 314 314 SER SER A . n A 1 113 LEU 113 315 315 LEU LEU A . n A 1 114 ARG 114 316 316 ARG ARG A . n A 1 115 ALA 115 317 317 ALA ALA A . n A 1 116 ALA 116 318 318 ALA ALA A . n A 1 117 VAL 117 319 319 VAL VAL A . n A 1 118 ARG 118 320 320 ARG ARG A . n A 1 119 TYR 119 321 321 TYR TYR A . n A 1 120 ASP 120 322 322 ASP ASP A . n A 1 121 PRO 121 323 323 PRO PRO A . n A 1 122 GLU 122 324 324 GLU GLU A . n A 1 123 SER 123 325 325 SER SER A . n A 1 124 GLU 124 326 326 GLU GLU A . n A 1 125 THR 125 327 327 THR THR A . n A 1 126 LEU 126 328 328 LEU LEU A . n A 1 127 THR 127 329 329 THR THR A . n A 1 128 LEU 128 330 330 LEU LEU A . n A 1 129 ASN 129 331 331 ASN ASN A . n A 1 130 GLY 130 332 332 GLY GLY A . n A 1 131 GLU 131 333 333 GLU GLU A . n A 1 132 MET 132 334 334 MET MET A . n A 1 133 ALA 133 335 335 ALA ALA A . n A 1 134 VAL 134 336 336 VAL VAL A . n A 1 135 THR 135 337 337 THR THR A . n A 1 136 ARG 136 338 338 ARG ARG A . n A 1 137 GLY 137 339 339 GLY GLY A . n A 1 138 GLN 138 340 340 GLN GLN A . n A 1 139 LEU 139 341 341 LEU LEU A . n A 1 140 LYS 140 342 342 LYS LYS A . n A 1 141 ASN 141 343 343 ASN ASN A . n A 1 142 GLY 142 344 344 GLY GLY A . n A 1 143 GLY 143 345 345 GLY GLY A . n A 1 144 LEU 144 346 346 LEU LEU A . n A 1 145 GLY 145 347 347 GLY GLY A . n A 1 146 VAL 146 348 348 VAL VAL A . n A 1 147 VAL 147 349 349 VAL VAL A . n A 1 148 SER 148 350 350 SER SER A . n A 1 149 ASP 149 351 351 ASP ASP A . n A 1 150 ALA 150 352 352 ALA ALA A . n A 1 151 ILE 151 353 353 ILE ILE A . n A 1 152 PHE 152 354 354 PHE PHE A . n A 1 153 ASP 153 355 355 ASP ASP A . n A 1 154 LEU 154 356 356 LEU LEU A . n A 1 155 GLY 155 357 357 GLY GLY A . n A 1 156 MET 156 358 358 MET MET A . n A 1 157 SER 157 359 359 SER SER A . n A 1 158 LEU 158 360 360 LEU LEU A . n A 1 159 SER 159 361 361 SER SER A . n A 1 160 SER 160 362 362 SER SER A . n A 1 161 PHE 161 363 363 PHE PHE A . n A 1 162 ASN 162 364 364 ASN ASN A . n A 1 163 LEU 163 365 365 LEU LEU A . n A 1 164 ASP 164 366 366 ASP ASP A . n A 1 165 ASP 165 367 367 ASP ASP A . n A 1 166 THR 166 368 368 THR THR A . n A 1 167 GLU 167 369 369 GLU GLU A . n A 1 168 VAL 168 370 370 VAL VAL A . n A 1 169 ALA 169 371 371 ALA ALA A . n A 1 170 LEU 170 372 372 LEU LEU A . n A 1 171 LEU 171 373 373 LEU LEU A . n A 1 172 GLN 172 374 374 GLN GLN A . n A 1 173 ALA 173 375 375 ALA ALA A . n A 1 174 VAL 174 376 376 VAL VAL A . n A 1 175 LEU 175 377 377 LEU LEU A . n A 1 176 LEU 176 378 378 LEU LEU A . n A 1 177 MET 177 379 379 MET MET A . n A 1 178 SER 178 380 380 SER SER A . n A 1 179 SER 179 381 381 SER SER A . n A 1 180 ASP 180 382 382 ASP ASP A . n A 1 181 ARG 181 383 383 ARG ARG A . n A 1 182 PRO 182 384 384 PRO PRO A . n A 1 183 GLY 183 385 385 GLY GLY A . n A 1 184 LEU 184 386 386 LEU LEU A . n A 1 185 ALA 185 387 387 ALA ALA A . n A 1 186 CYS 186 388 388 CYS CYS A . n A 1 187 VAL 187 389 389 VAL VAL A . n A 1 188 GLU 188 390 390 GLU GLU A . n A 1 189 ARG 189 391 391 ARG ARG A . n A 1 190 ILE 190 392 392 ILE ILE A . n A 1 191 GLU 191 393 393 GLU GLU A . n A 1 192 LYS 192 394 394 LYS LYS A . n A 1 193 TYR 193 395 395 TYR TYR A . n A 1 194 GLN 194 396 396 GLN GLN A . n A 1 195 ASP 195 397 397 ASP ASP A . n A 1 196 SER 196 398 398 SER SER A . n A 1 197 PHE 197 399 399 PHE PHE A . n A 1 198 LEU 198 400 400 LEU LEU A . n A 1 199 LEU 199 401 401 LEU LEU A . n A 1 200 ALA 200 402 402 ALA ALA A . n A 1 201 PHE 201 403 403 PHE PHE A . n A 1 202 GLU 202 404 404 GLU GLU A . n A 1 203 HIS 203 405 405 HIS HIS A . n A 1 204 TYR 204 406 406 TYR TYR A . n A 1 205 ILE 205 407 407 ILE ILE A . n A 1 206 ASN 206 408 408 ASN ASN A . n A 1 207 TYR 207 409 409 TYR TYR A . n A 1 208 ARG 208 410 410 ARG ARG A . n A 1 209 LYS 209 411 411 LYS LYS A . n A 1 210 HIS 210 412 412 HIS HIS A . n A 1 211 HIS 211 413 413 HIS HIS A . n A 1 212 VAL 212 414 414 VAL VAL A . n A 1 213 THR 213 415 415 THR THR A . n A 1 214 HIS 214 416 416 HIS HIS A . n A 1 215 PHE 215 417 417 PHE PHE A . n A 1 216 TRP 216 418 418 TRP TRP A . n A 1 217 PRO 217 419 419 PRO PRO A . n A 1 218 LYS 218 420 420 LYS LYS A . n A 1 219 LEU 219 421 421 LEU LEU A . n A 1 220 LEU 220 422 422 LEU LEU A . n A 1 221 MET 221 423 423 MET MET A . n A 1 222 LYS 222 424 424 LYS LYS A . n A 1 223 VAL 223 425 425 VAL VAL A . n A 1 224 THR 224 426 426 THR THR A . n A 1 225 ASP 225 427 427 ASP ASP A . n A 1 226 LEU 226 428 428 LEU LEU A . n A 1 227 ARG 227 429 429 ARG ARG A . n A 1 228 MET 228 430 430 MET MET A . n A 1 229 ILE 229 431 431 ILE ILE A . n A 1 230 GLY 230 432 432 GLY GLY A . n A 1 231 ALA 231 433 433 ALA ALA A . n A 1 232 CYS 232 434 434 CYS CYS A . n A 1 233 HIS 233 435 435 HIS HIS A . n A 1 234 ALA 234 436 436 ALA ALA A . n A 1 235 SER 235 437 437 SER SER A . n A 1 236 ARG 236 438 438 ARG ARG A . n A 1 237 PHE 237 439 439 PHE PHE A . n A 1 238 LEU 238 440 440 LEU LEU A . n A 1 239 HIS 239 441 441 HIS HIS A . n A 1 240 MET 240 442 442 MET MET A . n A 1 241 LYS 241 443 443 LYS LYS A . n A 1 242 VAL 242 444 444 VAL VAL A . n A 1 243 GLU 243 445 445 GLU GLU A . n A 1 244 CYS 244 446 446 CYS CYS A . n A 1 245 PRO 245 447 447 PRO PRO A . n A 1 246 THR 246 448 448 THR THR A . n A 1 247 GLU 247 449 449 GLU GLU A . n A 1 248 LEU 248 450 450 LEU LEU A . n A 1 249 PHE 249 451 451 PHE PHE A . n A 1 250 PRO 250 452 452 PRO PRO A . n A 1 251 PRO 251 453 453 PRO PRO A . n A 1 252 LEU 252 454 454 LEU LEU A . n A 1 253 PHE 253 455 455 PHE PHE A . n A 1 254 LEU 254 456 456 LEU LEU A . n A 1 255 GLU 255 457 457 GLU GLU A . n A 1 256 VAL 256 458 458 VAL VAL A . n A 1 257 PHE 257 459 459 PHE PHE A . n A 1 258 GLU 258 460 460 GLU GLU A . n A 1 259 ASP 259 461 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id 442 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 500 _pdbx_nonpoly_scheme.auth_seq_num 500 _pdbx_nonpoly_scheme.pdb_mon_id 442 _pdbx_nonpoly_scheme.auth_mon_id 442 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-02-15 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.19 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 AMoRE phasing . ? 4 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 351 ? ? CG A ASP 351 ? ? OD2 A ASP 351 ? ? 124.44 118.30 6.14 0.90 N 2 1 CB A ASP 382 ? ? CG A ASP 382 ? ? OD2 A ASP 382 ? ? 123.81 118.30 5.51 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 211 ? ? 55.79 70.89 2 1 PRO A 297 ? ? -43.72 159.39 3 1 ARG A 320 ? ? -98.40 35.93 4 1 GLU A 333 ? ? -134.36 -61.11 5 1 ASN A 364 ? ? 74.42 42.66 6 1 MET A 379 ? ? -96.47 56.87 7 1 LYS A 411 ? ? 41.52 74.18 8 1 VAL A 414 ? ? -166.32 106.26 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C17 _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id 442 _pdbx_validate_chiral.auth_seq_id 500 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 203 ? CG ? A GLU 1 CG 2 1 Y 1 A GLU 203 ? CD ? A GLU 1 CD 3 1 Y 1 A GLU 203 ? OE1 ? A GLU 1 OE1 4 1 Y 1 A GLU 203 ? OE2 ? A GLU 1 OE2 5 1 Y 1 A LYS 206 ? CG ? A LYS 4 CG 6 1 Y 1 A LYS 206 ? CD ? A LYS 4 CD 7 1 Y 1 A LYS 206 ? CE ? A LYS 4 CE 8 1 Y 1 A LYS 206 ? NZ ? A LYS 4 NZ 9 1 Y 1 A LYS 210 ? CG ? A LYS 8 CG 10 1 Y 1 A LYS 210 ? CD ? A LYS 8 CD 11 1 Y 1 A LYS 210 ? CE ? A LYS 8 CE 12 1 Y 1 A LYS 210 ? NZ ? A LYS 8 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 235 ? A GLN 33 2 1 Y 1 A GLY 236 ? A GLY 34 3 1 Y 1 A SER 237 ? A SER 35 4 1 Y 1 A HIS 238 ? A HIS 36 5 1 Y 1 A TRP 239 ? A TRP 37 6 1 Y 1 A LYS 240 ? A LYS 38 7 1 Y 1 A GLN 241 ? A GLN 39 8 1 Y 1 A LYS 242 ? A LYS 40 9 1 Y 1 A ALA 253 ? A ALA 51 10 1 Y 1 A PRO 254 ? A PRO 52 11 1 Y 1 A ILE 255 ? A ILE 53 12 1 Y 1 A VAL 256 ? A VAL 54 13 1 Y 1 A ASN 257 ? A ASN 55 14 1 Y 1 A ALA 258 ? A ALA 56 15 1 Y 1 A PRO 259 ? A PRO 57 16 1 Y 1 A GLU 260 ? A GLU 58 17 1 Y 1 A GLY 261 ? A GLY 59 18 1 Y 1 A GLY 262 ? A GLY 60 19 1 Y 1 A LYS 263 ? A LYS 61 20 1 Y 1 A ASP 461 ? A ASP 259 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '2-[3,5-DIBROMO-4-(4-HYDROXY-3-{HYDROXY[(2-PHENYLETHYL)AMINO]METHYL}PHENOXY)PHENYL]ETHANE-1,1-DIOL' _pdbx_entity_nonpoly.comp_id 442 #