data_1R6P # _entry.id 1R6P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1R6P pdb_00001r6p 10.2210/pdb1r6p/pdb RCSB RCSB020503 ? ? WWPDB D_1000020503 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1R2U _pdbx_database_related.details 'structure of the N-domain of trout cardiac troponin C at 30 C' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1R6P _pdbx_database_status.recvd_initial_deposition_date 2003-10-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Blumenschein, T.M.' 1 'Gillis, T.E.' 2 'Tibbits, G.F.' 3 'Sykes, B.D.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Effect of temperature on the structure of trout troponin C' Biochemistry 43 4955 4963 2004 BICHAW US 0006-2960 0033 ? 15109253 10.1021/bi035504z 1 'The effect of temperature and the F27W mutation on the Ca2+ activated structural transition of trout cardiac troponin C' Biochemistry 42 6418 6426 2003 BICHAW US 0006-2960 0033 ? ? 10.1021/bi0340494 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Blumenschein, T.M.' 1 ? primary 'Gillis, T.E.' 2 ? primary 'Tibbits, G.F.' 3 ? primary 'Sykes, B.D.' 4 ? 1 'Gillis, T.E.' 5 ? 1 'Blumenschein, T.M.A.' 6 ? 1 'Sykes, B.D.' 7 ? 1 'Tibbits, G.F.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'troponin C' 10142.326 1 ? ? 'N-terminal domain (residues 1-89)' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNDIYKAAVEQLTDEQKNEFKAAFDIFIQDAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRCMKDDS ; _entity_poly.pdbx_seq_one_letter_code_can ;MNDIYKAAVEQLTDEQKNEFKAAFDIFIQDAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRCMKDDS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ASP n 1 4 ILE n 1 5 TYR n 1 6 LYS n 1 7 ALA n 1 8 ALA n 1 9 VAL n 1 10 GLU n 1 11 GLN n 1 12 LEU n 1 13 THR n 1 14 ASP n 1 15 GLU n 1 16 GLN n 1 17 LYS n 1 18 ASN n 1 19 GLU n 1 20 PHE n 1 21 LYS n 1 22 ALA n 1 23 ALA n 1 24 PHE n 1 25 ASP n 1 26 ILE n 1 27 PHE n 1 28 ILE n 1 29 GLN n 1 30 ASP n 1 31 ALA n 1 32 GLU n 1 33 ASP n 1 34 GLY n 1 35 CYS n 1 36 ILE n 1 37 SER n 1 38 THR n 1 39 LYS n 1 40 GLU n 1 41 LEU n 1 42 GLY n 1 43 LYS n 1 44 VAL n 1 45 MET n 1 46 ARG n 1 47 MET n 1 48 LEU n 1 49 GLY n 1 50 GLN n 1 51 ASN n 1 52 PRO n 1 53 THR n 1 54 PRO n 1 55 GLU n 1 56 GLU n 1 57 LEU n 1 58 GLN n 1 59 GLU n 1 60 MET n 1 61 ILE n 1 62 ASP n 1 63 GLU n 1 64 VAL n 1 65 ASP n 1 66 GLU n 1 67 ASP n 1 68 GLY n 1 69 SER n 1 70 GLY n 1 71 THR n 1 72 VAL n 1 73 ASP n 1 74 PHE n 1 75 ASP n 1 76 GLU n 1 77 PHE n 1 78 LEU n 1 79 VAL n 1 80 MET n 1 81 MET n 1 82 VAL n 1 83 ARG n 1 84 CYS n 1 85 MET n 1 86 LYS n 1 87 ASP n 1 88 ASP n 1 89 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'rainbow trout' _entity_src_gen.gene_src_genus Oncorhynchus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oncorhynchus mykiss' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8022 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGex _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7ZZB9_ONCMY _struct_ref.pdbx_db_accession Q7ZZB9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNDIYKAAVEQLTDEQKNEFKAAFDIFIQDAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRCMKDDS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1R6P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7ZZB9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '15N HSQC' 2 1 1 DIPSI-HSQC 3 1 1 3D_15N-separated_NOESY 4 1 1 HNHA 5 1 1 HNHB 6 2 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 280 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM KCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.34 mM N-domain of trout cardiac troponin C U-15N; 10 mM imidazol; 100 mM KCl; 0.03% NaN3; 20 mM DTT; 0.2 mM DSS; ~4 mM CaCl2' '90% H2O/10% D2O' 2 '1.34 mM N-domain of trout cardiac troponin C U-15N; 10 mM imidazol; 100 mM KCl; 0.03% NaN3; 20 mM DTT; 0.2 mM DSS; ~4 mM CaCl2' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian UNITY 600 2 ? Varian INOVA 800 # _pdbx_nmr_refine.entry_id 1R6P _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1R6P _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 40 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1R6P _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 'April 2001' processing 'Delaglio, F., Grzesiek, S., Vuister,G.W., Zhu, G., Pfeifer, J. and Bax, A.' 1 VNMR 6.1c collection Varian 2 X-PLOR 3.851 refinement 'Brunger, A.T.' 3 NMRView 5.0.4 'data analysis' 'Johnson, B. and Blevins, R.' 4 # _exptl.entry_id 1R6P _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1R6P _struct.title 'NMR structure of the N-terminal domain of trout cardiac troponin C at 7 C' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1R6P _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'EF-hand, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 2 ? GLN A 11 ? ASN A 2 GLN A 11 1 ? 10 HELX_P HELX_P2 2 THR A 13 ? ILE A 28 ? THR A 13 ILE A 28 1 ? 16 HELX_P HELX_P3 3 LEU A 41 ? GLY A 49 ? LEU A 41 GLY A 49 1 ? 9 HELX_P HELX_P4 4 THR A 53 ? ASP A 65 ? THR A 53 ASP A 65 1 ? 13 HELX_P HELX_P5 5 PHE A 74 ? LYS A 86 ? PHE A 74 LYS A 86 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 65 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 65 A CA 90 1_555 ? ? ? ? ? ? ? 3.331 ? ? metalc2 metalc ? ? A ASP 65 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 65 A CA 90 1_555 ? ? ? ? ? ? ? 2.009 ? ? metalc3 metalc ? ? A ASP 67 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 67 A CA 90 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc4 metalc ? ? A ASP 67 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 67 A CA 90 1_555 ? ? ? ? ? ? ? 2.894 ? ? metalc5 metalc ? ? A SER 69 OG ? ? ? 1_555 B CA . CA ? ? A SER 69 A CA 90 1_555 ? ? ? ? ? ? ? 2.857 ? ? metalc6 metalc ? ? A THR 71 O ? ? ? 1_555 B CA . CA ? ? A THR 71 A CA 90 1_555 ? ? ? ? ? ? ? 2.801 ? ? metalc7 metalc ? ? A GLU 76 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 76 A CA 90 1_555 ? ? ? ? ? ? ? 2.750 ? ? metalc8 metalc ? ? A GLU 76 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 76 A CA 90 1_555 ? ? ? ? ? ? ? 2.856 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 35 ? SER A 37 ? CYS A 35 SER A 37 A 2 THR A 71 ? ASP A 73 ? THR A 71 ASP A 73 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 36 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 36 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 72 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 72 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 90 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 90' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 65 ? ASP A 65 . ? 1_555 ? 2 AC1 5 ASP A 67 ? ASP A 67 . ? 1_555 ? 3 AC1 5 SER A 69 ? SER A 69 . ? 1_555 ? 4 AC1 5 THR A 71 ? THR A 71 . ? 1_555 ? 5 AC1 5 GLU A 76 ? GLU A 76 . ? 1_555 ? # _database_PDB_matrix.entry_id 1R6P _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1R6P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 SER 89 89 89 SER SER A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 90 _pdbx_nonpoly_scheme.auth_seq_num 90 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OD2 ? A ASP 65 ? A ASP 65 ? 1_555 38.4 ? 2 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 130.3 ? 3 OD2 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 91.9 ? 4 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 121.5 ? 5 OD2 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 99.3 ? 6 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 47.9 ? 7 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OG ? A SER 69 ? A SER 69 ? 1_555 117.5 ? 8 OD2 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OG ? A SER 69 ? A SER 69 ? 1_555 105.4 ? 9 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OG ? A SER 69 ? A SER 69 ? 1_555 67.5 ? 10 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OG ? A SER 69 ? A SER 69 ? 1_555 110.8 ? 11 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 O ? A THR 71 ? A THR 71 ? 1_555 56.6 ? 12 OD2 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 O ? A THR 71 ? A THR 71 ? 1_555 86.3 ? 13 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 O ? A THR 71 ? A THR 71 ? 1_555 146.0 ? 14 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 O ? A THR 71 ? A THR 71 ? 1_555 165.4 ? 15 OG ? A SER 69 ? A SER 69 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 O ? A THR 71 ? A THR 71 ? 1_555 80.3 ? 16 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 60.0 ? 17 OD2 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 92.9 ? 18 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 148.0 ? 19 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 100.1 ? 20 OG ? A SER 69 ? A SER 69 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 140.4 ? 21 O ? A THR 71 ? A THR 71 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 66.0 ? 22 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 65.0 ? 23 OD2 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 73.2 ? 24 OD2 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 107.0 ? 25 OD1 ? A ASP 67 ? A ASP 67 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 64.5 ? 26 OG ? A SER 69 ? A SER 69 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 174.4 ? 27 O ? A THR 71 ? A THR 71 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 104.9 ? 28 OE1 ? A GLU 76 ? A GLU 76 ? 1_555 CA ? B CA . ? A CA 90 ? 1_555 OE2 ? A GLU 76 ? A GLU 76 ? 1_555 45.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-06-08 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 87 ? ? -175.53 -38.86 2 2 ASP A 33 ? ? -146.89 -47.59 3 2 LYS A 86 ? ? 72.76 155.94 4 3 ASN A 2 ? ? -159.42 44.75 5 3 ASP A 33 ? ? -155.88 -47.57 6 3 PRO A 52 ? ? -82.93 -159.80 7 3 LYS A 86 ? ? 70.85 158.74 8 3 ASP A 88 ? ? 67.98 104.22 9 4 ASN A 2 ? ? 63.80 90.26 10 4 ASN A 51 ? ? -155.82 63.17 11 4 PRO A 52 ? ? -84.88 -158.67 12 5 GLU A 32 ? ? -109.07 43.54 13 5 ASP A 33 ? ? -159.39 -48.15 14 5 ASN A 51 ? ? -155.13 71.03 15 5 ASP A 87 ? ? -163.06 35.43 16 5 ASP A 88 ? ? 62.88 88.58 17 6 ASN A 51 ? ? -150.01 83.30 18 6 ASP A 87 ? ? -169.13 40.55 19 6 ASP A 88 ? ? 58.48 98.64 20 7 ASP A 87 ? ? 60.39 68.63 21 8 ASN A 2 ? ? -143.54 31.01 22 8 PRO A 52 ? ? -84.44 -159.57 23 8 LYS A 86 ? ? 66.68 162.49 24 9 ASP A 65 ? ? -51.93 102.47 25 9 ASP A 87 ? ? 64.74 65.08 26 10 ASN A 2 ? ? -140.37 51.07 27 10 ASP A 33 ? ? -131.85 -45.61 28 10 PRO A 52 ? ? -84.53 -159.60 29 10 LYS A 86 ? ? 74.64 138.58 30 10 ASP A 88 ? ? -177.51 62.75 31 11 ILE A 28 ? ? -109.68 65.32 32 11 ASP A 33 ? ? -145.39 -49.01 33 11 LYS A 86 ? ? 72.31 121.34 34 11 ASP A 88 ? ? -172.23 -55.47 35 12 ASN A 51 ? ? -158.22 72.03 36 12 PRO A 52 ? ? -84.38 -159.16 37 12 LYS A 86 ? ? 77.53 113.98 38 12 ASP A 87 ? ? -99.24 37.08 39 12 ASP A 88 ? ? -167.17 55.19 40 13 GLU A 32 ? ? -107.25 44.95 41 13 ASP A 33 ? ? -159.46 -47.34 42 13 LYS A 86 ? ? 75.69 133.65 43 13 ASP A 88 ? ? -156.22 -61.24 44 14 ASP A 33 ? ? -140.10 -46.18 45 14 PRO A 52 ? ? -84.44 -159.60 46 14 ASP A 88 ? ? 69.81 -69.15 47 15 ASN A 2 ? ? 63.44 95.44 48 15 ASP A 33 ? ? -154.61 -51.27 49 15 LYS A 86 ? ? 67.70 156.39 50 15 ASP A 88 ? ? -173.27 115.87 51 16 ASP A 33 ? ? -149.71 18.25 52 16 PRO A 52 ? ? -83.50 -159.94 53 16 LYS A 86 ? ? 66.30 154.77 54 16 ASP A 88 ? ? 59.98 91.10 55 17 ASP A 33 ? ? -139.90 -48.74 56 17 ASP A 87 ? ? -172.78 38.91 57 17 ASP A 88 ? ? 60.41 94.79 58 18 ILE A 28 ? ? -107.59 61.32 59 18 ASP A 33 ? ? -135.59 -48.24 60 18 PRO A 52 ? ? -83.95 -159.17 61 18 ASP A 87 ? ? 71.02 51.93 62 18 ASP A 88 ? ? 69.01 120.96 63 19 ASN A 2 ? ? 58.13 73.38 64 19 ASP A 33 ? ? -142.51 -47.90 65 19 ASP A 88 ? ? -124.40 -53.35 66 20 ASP A 33 ? ? -151.65 -49.79 67 20 PRO A 52 ? ? -84.12 -159.54 68 20 LYS A 86 ? ? 71.86 130.57 69 21 ASP A 87 ? ? -176.29 -41.61 70 22 ASP A 33 ? ? -149.24 -47.08 71 22 LYS A 86 ? ? 70.46 127.32 72 22 ASP A 88 ? ? 72.29 104.00 73 23 LYS A 86 ? ? 47.97 178.30 74 23 ASP A 88 ? ? -162.37 97.50 75 24 ASN A 2 ? ? 59.27 90.61 76 24 ASP A 65 ? ? -59.06 97.84 77 25 ASP A 33 ? ? -143.92 15.20 78 25 ASP A 87 ? ? -174.83 79.96 79 26 ASP A 33 ? ? -139.25 -48.01 80 26 ASN A 51 ? ? -152.16 66.37 81 26 ASP A 65 ? ? -52.79 104.20 82 26 ASP A 87 ? ? -176.14 45.54 83 26 ASP A 88 ? ? -114.81 60.25 84 27 ASP A 33 ? ? -146.37 -49.64 85 27 LYS A 86 ? ? 72.38 112.92 86 27 ASP A 87 ? ? -96.64 44.38 87 27 ASP A 88 ? ? -147.03 49.45 88 28 ILE A 28 ? ? -109.98 40.53 89 28 ASP A 30 ? ? -96.23 44.55 90 28 ASP A 33 ? ? -157.85 -44.61 91 28 ASN A 51 ? ? -143.61 58.25 92 28 PRO A 52 ? ? -79.63 -160.96 93 28 ASP A 88 ? ? -156.38 -58.94 94 29 ASP A 33 ? ? -139.91 -47.69 95 29 ASN A 51 ? ? -149.93 54.36 96 29 PRO A 52 ? ? -77.20 -160.48 97 29 ASP A 87 ? ? 61.98 87.65 98 30 ASP A 33 ? ? -125.59 -51.55 99 30 ASP A 87 ? ? 59.80 78.65 100 31 ILE A 28 ? ? -98.05 38.94 101 32 ASP A 33 ? ? -138.89 -48.85 102 32 ASP A 87 ? ? -174.44 67.43 103 32 ASP A 88 ? ? -160.98 -58.37 104 33 PRO A 52 ? ? -83.29 -159.74 105 33 ASP A 65 ? ? -59.29 98.06 106 33 LYS A 86 ? ? 69.68 160.43 107 34 ASN A 2 ? ? -145.54 34.44 108 34 PRO A 52 ? ? -82.27 -158.92 109 34 ASP A 65 ? ? -55.20 103.01 110 34 LYS A 86 ? ? 73.76 120.49 111 35 ASN A 2 ? ? 38.73 44.11 112 35 ILE A 28 ? ? -105.10 40.45 113 35 PRO A 52 ? ? -83.63 -159.17 114 35 LYS A 86 ? ? 74.56 110.84 115 36 ASN A 51 ? ? -159.37 87.65 116 36 LYS A 86 ? ? 71.30 104.34 117 37 ASP A 33 ? ? -133.97 -48.85 118 37 ASN A 51 ? ? -150.54 65.72 119 37 PRO A 52 ? ? -82.97 -159.76 120 37 ASP A 87 ? ? -168.53 47.15 121 37 ASP A 88 ? ? 59.59 83.07 122 38 ASP A 33 ? ? -141.22 -52.84 123 38 ASN A 51 ? ? -152.02 67.45 124 38 ASP A 87 ? ? -158.15 38.01 125 38 ASP A 88 ? ? -138.93 -46.64 126 39 ASN A 2 ? ? -164.52 67.37 127 39 ASP A 33 ? ? -143.80 -48.16 128 39 ASN A 51 ? ? -157.42 80.39 129 39 PRO A 52 ? ? -83.98 -159.94 130 39 ASP A 65 ? ? -62.17 96.24 131 39 MET A 85 ? ? -90.39 -65.87 132 39 ASP A 87 ? ? -169.47 50.14 133 39 ASP A 88 ? ? -169.06 -60.14 134 40 ASP A 33 ? ? -130.67 -47.56 135 40 ASP A 87 ? ? -169.52 -44.11 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #