data_1R82 # _entry.id 1R82 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1R82 pdb_00001r82 10.2210/pdb1r82/pdb RCSB RCSB020552 ? ? WWPDB D_1000020552 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1R7T 'related glycosyltransferase, different acceptor' unspecified PDB 1R7U 'same glycosyltransferase, different acceptor' unspecified PDB 1R7V 'related glycosyltransferase, same acceptor' unspecified PDB 1R7X 'same glycosyltransferase, same acceptor' unspecified PDB 1R7Y 'related glycosyltransferase, same acceptor, presence of UDP' unspecified PDB 1R80 'same glycosyltransferase, same acceptor, presence of UDP' unspecified PDB 1R81 'related glycosyltransferase, same acceptor, presence of UDP-donor' unspecified # _pdbx_database_status.entry_id 1R82 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2003-10-22 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nguyen, H.P.' 1 'Seto, N.O.L.' 2 'Cai, Y.' 3 'Leinala, E.K.' 4 'Borisova, S.N.' 5 'Palcic, M.M.' 6 'Evans, S.V.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;The influence of an intramolecular hydrogen bond in differential recognition of inhibitory acceptor analogs by human ABO(H) blood group A and B glycosyltransferases ; J.Biol.Chem. 278 49191 49195 2003 JBCHA3 US 0021-9258 0071 ? 12972418 10.1074/jbc.M308770200 1 'Crystallography & NMR System' 'Acta Crystallogr.,Sect.D' 54 905 921 1998 ABCRE6 DK 0907-4449 0766 ? ? 10.1107/S0907444998003254 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nguyen, H.P.' 1 ? primary 'Seto, N.O.L.' 2 ? primary 'Cai, Y.' 3 ? primary 'Leinala, E.K.' 4 ? primary 'Borisova, S.N.' 5 ? primary 'Palcic, M.M.' 6 ? primary 'Evans, S.V.' 7 ? 1 'Brunger, A.T.' 8 ? 1 'Adams, P.D.' 9 ? 1 'Clore, G.M.' 10 ? 1 'Delano, W.L.' 11 ? 1 'Gros, P.' 12 ? 1 'Grosse-Kunstleve, R.' 13 ? 1 'Jiang, J.-S.' 14 ? 1 'Kuszewski, J.' 15 ? 1 'Nilges, M.' 16 ? 1 'Pannu, N.S.' 17 ? 1 'Read, R.J.' 18 ? 1 'Rice, L.M.' 19 ? 1 'Simonson, T.' 20 ? 1 'Warren, G.' 21 ? # _cell.entry_id 1R82 _cell.length_a 52.800 _cell.length_b 150.400 _cell.length_c 79.500 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.pdbx_unique_axis ? _cell.Z_PDB 8 # _symmetry.entry_id 1R82 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 20 _symmetry.cell_setting ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Glycoprotein-fucosylgalactoside alpha-galactosyltransferase' 32961.098 1 2.4.1.37 ? 'Catalytic Domain (Residues 63-345)' ? 2 branched man 'alpha-L-fucopyranose-(1-2)-octyl 3-amino-3-deoxy-beta-D-galactopyranoside' 437.525 1 ? ? ? ? 3 non-polymer man "GALACTOSE-URIDINE-5'-DIPHOSPHATE" 566.302 1 ? ? ? ? 4 non-polymer syn 'MERCURY (II) ION' 200.590 2 ? ? ? ? 5 water nat water 18.015 197 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Glycosyltransferase B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFM VGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGV EILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHD ESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFM VGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGV EILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHD ESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 LEU n 1 5 PRO n 1 6 ARG n 1 7 MET n 1 8 VAL n 1 9 TYR n 1 10 PRO n 1 11 GLN n 1 12 PRO n 1 13 LYS n 1 14 VAL n 1 15 LEU n 1 16 THR n 1 17 PRO n 1 18 CYS n 1 19 ARG n 1 20 LYS n 1 21 ASP n 1 22 VAL n 1 23 LEU n 1 24 VAL n 1 25 VAL n 1 26 THR n 1 27 PRO n 1 28 TRP n 1 29 LEU n 1 30 ALA n 1 31 PRO n 1 32 ILE n 1 33 VAL n 1 34 TRP n 1 35 GLU n 1 36 GLY n 1 37 THR n 1 38 PHE n 1 39 ASN n 1 40 ILE n 1 41 ASP n 1 42 ILE n 1 43 LEU n 1 44 ASN n 1 45 GLU n 1 46 GLN n 1 47 PHE n 1 48 ARG n 1 49 LEU n 1 50 GLN n 1 51 ASN n 1 52 THR n 1 53 THR n 1 54 ILE n 1 55 GLY n 1 56 LEU n 1 57 THR n 1 58 VAL n 1 59 PHE n 1 60 ALA n 1 61 ILE n 1 62 LYS n 1 63 LYS n 1 64 TYR n 1 65 VAL n 1 66 ALA n 1 67 PHE n 1 68 LEU n 1 69 LYS n 1 70 LEU n 1 71 PHE n 1 72 LEU n 1 73 GLU n 1 74 THR n 1 75 ALA n 1 76 GLU n 1 77 LYS n 1 78 HIS n 1 79 PHE n 1 80 MET n 1 81 VAL n 1 82 GLY n 1 83 HIS n 1 84 ARG n 1 85 VAL n 1 86 HIS n 1 87 TYR n 1 88 TYR n 1 89 VAL n 1 90 PHE n 1 91 THR n 1 92 ASP n 1 93 GLN n 1 94 PRO n 1 95 ALA n 1 96 ALA n 1 97 VAL n 1 98 PRO n 1 99 ARG n 1 100 VAL n 1 101 THR n 1 102 LEU n 1 103 GLY n 1 104 THR n 1 105 GLY n 1 106 ARG n 1 107 GLN n 1 108 LEU n 1 109 SER n 1 110 VAL n 1 111 LEU n 1 112 GLU n 1 113 VAL n 1 114 GLY n 1 115 ALA n 1 116 TYR n 1 117 LYS n 1 118 ARG n 1 119 TRP n 1 120 GLN n 1 121 ASP n 1 122 VAL n 1 123 SER n 1 124 MET n 1 125 ARG n 1 126 ARG n 1 127 MET n 1 128 GLU n 1 129 MET n 1 130 ILE n 1 131 SER n 1 132 ASP n 1 133 PHE n 1 134 CYS n 1 135 GLU n 1 136 ARG n 1 137 ARG n 1 138 PHE n 1 139 LEU n 1 140 SER n 1 141 GLU n 1 142 VAL n 1 143 ASP n 1 144 TYR n 1 145 LEU n 1 146 VAL n 1 147 CYS n 1 148 VAL n 1 149 ASP n 1 150 VAL n 1 151 ASP n 1 152 MET n 1 153 GLU n 1 154 PHE n 1 155 ARG n 1 156 ASP n 1 157 HIS n 1 158 VAL n 1 159 GLY n 1 160 VAL n 1 161 GLU n 1 162 ILE n 1 163 LEU n 1 164 THR n 1 165 PRO n 1 166 LEU n 1 167 PHE n 1 168 GLY n 1 169 THR n 1 170 LEU n 1 171 HIS n 1 172 PRO n 1 173 SER n 1 174 PHE n 1 175 TYR n 1 176 GLY n 1 177 SER n 1 178 SER n 1 179 ARG n 1 180 GLU n 1 181 ALA n 1 182 PHE n 1 183 THR n 1 184 TYR n 1 185 GLU n 1 186 ARG n 1 187 ARG n 1 188 PRO n 1 189 GLN n 1 190 SER n 1 191 GLN n 1 192 ALA n 1 193 TYR n 1 194 ILE n 1 195 PRO n 1 196 LYS n 1 197 ASP n 1 198 GLU n 1 199 GLY n 1 200 ASP n 1 201 PHE n 1 202 TYR n 1 203 TYR n 1 204 MET n 1 205 GLY n 1 206 ALA n 1 207 PHE n 1 208 PHE n 1 209 GLY n 1 210 GLY n 1 211 SER n 1 212 VAL n 1 213 GLN n 1 214 GLU n 1 215 VAL n 1 216 GLN n 1 217 ARG n 1 218 LEU n 1 219 THR n 1 220 ARG n 1 221 ALA n 1 222 CYS n 1 223 HIS n 1 224 GLN n 1 225 ALA n 1 226 MET n 1 227 MET n 1 228 VAL n 1 229 ASP n 1 230 GLN n 1 231 ALA n 1 232 ASN n 1 233 GLY n 1 234 ILE n 1 235 GLU n 1 236 ALA n 1 237 VAL n 1 238 TRP n 1 239 HIS n 1 240 ASP n 1 241 GLU n 1 242 SER n 1 243 HIS n 1 244 LEU n 1 245 ASN n 1 246 LYS n 1 247 TYR n 1 248 LEU n 1 249 LEU n 1 250 ARG n 1 251 HIS n 1 252 LYS n 1 253 PRO n 1 254 THR n 1 255 LYS n 1 256 VAL n 1 257 LEU n 1 258 SER n 1 259 PRO n 1 260 GLU n 1 261 TYR n 1 262 LEU n 1 263 TRP n 1 264 ASP n 1 265 GLN n 1 266 GLN n 1 267 LEU n 1 268 LEU n 1 269 GLY n 1 270 TRP n 1 271 PRO n 1 272 ALA n 1 273 VAL n 1 274 LEU n 1 275 ARG n 1 276 LYS n 1 277 LEU n 1 278 ARG n 1 279 PHE n 1 280 THR n 1 281 ALA n 1 282 VAL n 1 283 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BGAT_HUMAN _struct_ref.pdbx_db_accession P16442 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMV GHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVE ILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDE SHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP ; _struct_ref.pdbx_align_begin 64 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1R82 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 283 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16442 _struct_ref_seq.db_align_beg 64 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 345 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 64 _struct_ref_seq.pdbx_auth_seq_align_end 345 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1R82 MET A 1 ? UNP P16442 ? ? 'initiating methionine' 63 1 1 1R82 GLY A 114 ? UNP P16442 ARG 176 'SEE REMARK 999' 176 2 1 1R82 SER A 173 ? UNP P16442 GLY 235 'SEE REMARK 999' 235 3 1 1R82 MET A 204 ? UNP P16442 LEU 266 'SEE REMARK 999' 266 4 1 1R82 ALA A 206 ? UNP P16442 GLY 268 'SEE REMARK 999' 268 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 AOG D-saccharide . 'octyl 3-amino-3-deoxy-beta-D-galactopyranoside' ;4-AMINO-2-OCTYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,5-DIOL; octyl 3-amino-3-deoxy-beta-D-galactoside; octyl 3-amino-3-deoxy-D-galactoside; octyl 3-amino-3-deoxy-galactoside ; 'C14 H29 N O5' 291.384 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose 'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5' 164.156 GDU non-polymer . "GALACTOSE-URIDINE-5'-DIPHOSPHATE" UDP-D-GALACTOPYRANOSE 'C15 H24 N2 O17 P2' 566.302 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HG non-polymer . 'MERCURY (II) ION' ? 'Hg 2' 200.590 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1R82 _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 47.15 _exptl_crystal.density_Matthews 2.35 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.15 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X8C' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.15 _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X8C # _reflns.entry_id 1R82 _reflns.d_resolution_high 1.55 _reflns.d_resolution_low 49.82 _reflns.limit_h_max 33 _reflns.limit_h_min 0 _reflns.limit_k_max 97 _reflns.limit_k_min 0 _reflns.limit_l_max 51 _reflns.limit_l_min 0 _reflns.number_all 46129 _reflns.observed_criterion_sigma_F .0 _reflns.observed_criterion_F_max 687002.12 _reflns.observed_criterion_F_min .320000 _reflns.B_iso_Wilson_estimate 19.3 _reflns.observed_criterion_sigma_I ? _reflns.number_obs ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 1R82 _refine.ls_number_reflns_all 46357 _refine.ls_number_reflns_obs 45654 _refine.ls_percent_reflns_obs 98.5 _refine.ls_d_res_high 1.55 _refine.ls_d_res_low 49.82 _refine.B_iso_min 7.87 _refine.B_iso_max 68.58 _refine.B_iso_mean 20.63 _refine.occupancy_min 1.00 _refine.occupancy_max 1.00 _refine.aniso_B[1][1] -1.28 _refine.aniso_B[2][2] .66 _refine.aniso_B[3][3] .62 _refine.aniso_B[1][2] .00 _refine.aniso_B[1][3] .00 _refine.aniso_B[2][3] .00 _refine.solvent_model_param_bsol 55.4526 _refine.solvent_model_param_ksol .39516 _refine.solvent_model_details 'CNS bulk solvent model used' _refine.ls_R_factor_R_work 0.242 _refine.ls_R_factor_R_free 0.258 _refine.ls_R_factor_R_free_error .004 _refine.ls_number_reflns_R_free 4602 _refine.ls_percent_reflns_R_free 10.1 _refine.details ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_I ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_isotropic_thermal_model ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1R82 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.pdbx_Luzzati_d_res_high_obs 1.55 _refine_analyze.Luzzati_coordinate_error_obs .21 _refine_analyze.Luzzati_sigma_a_obs .13 _refine_analyze.Luzzati_coordinate_error_free .22 _refine_analyze.Luzzati_sigma_a_free .17 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2149 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 57 _refine_hist.number_atoms_solvent 197 _refine_hist.number_atoms_total 2403 _refine_hist.d_res_high 1.55 _refine_hist.d_res_low 49.82 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d .005 . ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 . ? ? 'X-RAY DIFFRACTION' ? c_torsion_deg 23.8 . ? ? 'X-RAY DIFFRACTION' ? c_torsion_impr_deg .83 . ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_all 1.55 1.61 4594 4353 3928 94.8 0.279 0.322 .016 425 9.8 10 . 'X-RAY DIFFRACTION' . 1.61 1.67 4582 4501 4016 98.2 0.266 0.291 .013 485 10.8 10 . 'X-RAY DIFFRACTION' . 1.67 1.75 4592 4525 4090 98.5 0.268 0.31 .015 435 9.6 10 . 'X-RAY DIFFRACTION' . 1.75 1.84 4603 4545 4085 98.7 0.252 0.263 .012 460 10.1 10 . 'X-RAY DIFFRACTION' . 1.84 1.95 4625 4553 4107 98.4 0.25 0.28 .013 446 9.8 10 . 'X-RAY DIFFRACTION' . 1.95 2.10 4600 4554 4062 99.0 0.246 0.267 .012 492 10.8 10 . 'X-RAY DIFFRACTION' . 2.10 2.32 4631 4597 4124 99.2 0.248 0.259 .012 473 10.3 10 . 'X-RAY DIFFRACTION' . 2.32 2.65 4669 4654 4211 99.7 0.241 0.238 .011 443 9.5 10 . 'X-RAY DIFFRACTION' . 2.65 3.34 4668 4646 4171 99.5 0.239 0.245 .011 475 10.2 10 . 'X-RAY DIFFRACTION' . 3.34 49.82 4866 4726 4258 97.1 0.229 0.247 .011 468 9.9 10 . 'X-RAY DIFFRACTION' . # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 carbohydrate_c8.param carbohydrate_AA_c8.top 'X-RAY DIFFRACTION' 3 ion.param ion.top 'X-RAY DIFFRACTION' 4 water_rep.param water.top 'X-RAY DIFFRACTION' 5 udp.param udp.top 'X-RAY DIFFRACTION' # _struct.entry_id 1R82 _struct.title 'Glycosyltransferase B in complex with 3-amino-acceptor analog inhibitor, and uridine diphosphate-galactose' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1R82 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'Glycoprotein, transmembrane, signal-anchor, blood group antigen, Transferase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 39 ? LEU A 49 ? ASN A 101 LEU A 111 1 ? 11 HELX_P HELX_P2 2 ILE A 61 ? ALA A 66 ? ILE A 123 ALA A 128 5 ? 6 HELX_P HELX_P3 3 PHE A 67 ? PHE A 79 ? PHE A 129 PHE A 141 1 ? 13 HELX_P HELX_P4 4 GLN A 93 ? VAL A 97 ? GLN A 155 VAL A 159 5 ? 5 HELX_P HELX_P5 5 GLU A 135 ? VAL A 142 ? GLU A 197 VAL A 204 1 ? 8 HELX_P HELX_P6 6 GLY A 159 ? LEU A 163 ? GLY A 221 LEU A 225 5 ? 5 HELX_P HELX_P7 7 SER A 178 ? PHE A 182 ? SER A 240 PHE A 244 5 ? 5 HELX_P HELX_P8 8 VAL A 212 ? ASN A 232 ? VAL A 274 ASN A 294 1 ? 21 HELX_P HELX_P9 9 HIS A 239 ? HIS A 251 ? HIS A 301 HIS A 313 1 ? 13 HELX_P HELX_P10 10 PRO A 259 ? LEU A 262 ? PRO A 321 LEU A 324 5 ? 4 HELX_P HELX_P11 11 ASP A 264 ? GLY A 269 ? ASP A 326 GLY A 331 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B AOG . O2 ? ? ? 1_555 B FUC . C1 ? ? B AOG 1 B FUC 2 1_555 ? ? ? ? ? ? ? 1.389 ? ? metalc1 metalc ? ? A THR 57 OG1 ? ? ? 1_555 E HG . HG ? ? A THR 119 A HG 403 1_555 ? ? ? ? ? ? ? 2.890 ? ? metalc2 metalc ? ? A CYS 147 SG ? ? ? 1_555 E HG . HG ? ? A CYS 209 A HG 403 1_555 ? ? ? ? ? ? ? 2.195 ? ? metalc3 metalc ? ? A CYS 222 SG ? ? ? 1_555 D HG . HG ? ? A CYS 284 A HG 402 1_555 ? ? ? ? ? ? ? 2.613 ? ? metalc4 metalc ? ? E HG . HG ? ? ? 1_555 F HOH . O ? ? A HG 403 A HOH 660 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc5 metalc ? ? E HG . HG ? ? ? 1_555 F HOH . O ? ? A HG 403 A HOH 666 1_555 ? ? ? ? ? ? ? 2.246 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? parallel A 6 7 ? parallel A 7 8 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 32 ? VAL A 33 ? ILE A 94 VAL A 95 A 2 LYS A 255 ? LEU A 257 ? LYS A 317 LEU A 319 A 3 LEU A 166 ? THR A 169 ? LEU A 228 THR A 231 A 4 PHE A 207 ? SER A 211 ? PHE A 269 SER A 273 A 5 TYR A 144 ? VAL A 148 ? TYR A 206 VAL A 210 A 6 THR A 53 ? ALA A 60 ? THR A 115 ALA A 122 A 7 ARG A 84 ? THR A 91 ? ARG A 146 THR A 153 A 8 ARG A 106 ? GLU A 112 ? ARG A 168 GLU A 174 B 1 MET A 152 ? PHE A 154 ? MET A 214 PHE A 216 B 2 PHE A 279 ? ALA A 281 ? PHE A 341 ALA A 343 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 33 ? N VAL A 95 O VAL A 256 ? O VAL A 318 A 2 3 O LEU A 257 ? O LEU A 319 N GLY A 168 ? N GLY A 230 A 3 4 N PHE A 167 ? N PHE A 229 O GLY A 209 ? O GLY A 271 A 4 5 O PHE A 208 ? O PHE A 270 N CYS A 147 ? N CYS A 209 A 5 6 O TYR A 144 ? O TYR A 206 N GLY A 55 ? N GLY A 117 A 6 7 N ALA A 60 ? N ALA A 122 O PHE A 90 ? O PHE A 152 A 7 8 N TYR A 87 ? N TYR A 149 O GLN A 107 ? O GLN A 169 B 1 2 N GLU A 153 ? N GLU A 215 O THR A 280 ? O THR A 342 # _atom_sites.entry_id 1R82 _atom_sites.fract_transf_matrix[1][1] .018939 _atom_sites.fract_transf_matrix[1][2] .000000 _atom_sites.fract_transf_matrix[1][3] .000000 _atom_sites.fract_transf_matrix[2][1] .000000 _atom_sites.fract_transf_matrix[2][2] .006649 _atom_sites.fract_transf_matrix[2][3] .000000 _atom_sites.fract_transf_matrix[3][1] .000000 _atom_sites.fract_transf_matrix[3][2] .000000 _atom_sites.fract_transf_matrix[3][3] .012579 _atom_sites.fract_transf_vector[1] .000000 _atom_sites.fract_transf_vector[2] .000000 _atom_sites.fract_transf_vector[3] .000000 # loop_ _atom_type.symbol C HG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 63 63 MET MET A . n A 1 2 VAL 2 64 64 VAL VAL A . n A 1 3 SER 3 65 65 SER SER A . n A 1 4 LEU 4 66 66 LEU LEU A . n A 1 5 PRO 5 67 67 PRO PRO A . n A 1 6 ARG 6 68 68 ARG ARG A . n A 1 7 MET 7 69 69 MET MET A . n A 1 8 VAL 8 70 70 VAL VAL A . n A 1 9 TYR 9 71 71 TYR TYR A . n A 1 10 PRO 10 72 72 PRO PRO A . n A 1 11 GLN 11 73 73 GLN GLN A . n A 1 12 PRO 12 74 74 PRO PRO A . n A 1 13 LYS 13 75 75 LYS LYS A . n A 1 14 VAL 14 76 76 VAL VAL A . n A 1 15 LEU 15 77 77 LEU LEU A . n A 1 16 THR 16 78 78 THR THR A . n A 1 17 PRO 17 79 79 PRO PRO A . n A 1 18 CYS 18 80 80 CYS CYS A . n A 1 19 ARG 19 81 81 ARG ARG A . n A 1 20 LYS 20 82 82 LYS LYS A . n A 1 21 ASP 21 83 83 ASP ASP A . n A 1 22 VAL 22 84 84 VAL VAL A . n A 1 23 LEU 23 85 85 LEU LEU A . n A 1 24 VAL 24 86 86 VAL VAL A . n A 1 25 VAL 25 87 87 VAL VAL A . n A 1 26 THR 26 88 88 THR THR A . n A 1 27 PRO 27 89 89 PRO PRO A . n A 1 28 TRP 28 90 90 TRP TRP A . n A 1 29 LEU 29 91 91 LEU LEU A . n A 1 30 ALA 30 92 92 ALA ALA A . n A 1 31 PRO 31 93 93 PRO PRO A . n A 1 32 ILE 32 94 94 ILE ILE A . n A 1 33 VAL 33 95 95 VAL VAL A . n A 1 34 TRP 34 96 96 TRP TRP A . n A 1 35 GLU 35 97 97 GLU GLU A . n A 1 36 GLY 36 98 98 GLY GLY A . n A 1 37 THR 37 99 99 THR THR A . n A 1 38 PHE 38 100 100 PHE PHE A . n A 1 39 ASN 39 101 101 ASN ASN A . n A 1 40 ILE 40 102 102 ILE ILE A . n A 1 41 ASP 41 103 103 ASP ASP A . n A 1 42 ILE 42 104 104 ILE ILE A . n A 1 43 LEU 43 105 105 LEU LEU A . n A 1 44 ASN 44 106 106 ASN ASN A . n A 1 45 GLU 45 107 107 GLU GLU A . n A 1 46 GLN 46 108 108 GLN GLN A . n A 1 47 PHE 47 109 109 PHE PHE A . n A 1 48 ARG 48 110 110 ARG ARG A . n A 1 49 LEU 49 111 111 LEU LEU A . n A 1 50 GLN 50 112 112 GLN GLN A . n A 1 51 ASN 51 113 113 ASN ASN A . n A 1 52 THR 52 114 114 THR THR A . n A 1 53 THR 53 115 115 THR THR A . n A 1 54 ILE 54 116 116 ILE ILE A . n A 1 55 GLY 55 117 117 GLY GLY A . n A 1 56 LEU 56 118 118 LEU LEU A . n A 1 57 THR 57 119 119 THR THR A . n A 1 58 VAL 58 120 120 VAL VAL A . n A 1 59 PHE 59 121 121 PHE PHE A . n A 1 60 ALA 60 122 122 ALA ALA A . n A 1 61 ILE 61 123 123 ILE ILE A . n A 1 62 LYS 62 124 124 LYS LYS A . n A 1 63 LYS 63 125 125 LYS LYS A . n A 1 64 TYR 64 126 126 TYR TYR A . n A 1 65 VAL 65 127 127 VAL VAL A . n A 1 66 ALA 66 128 128 ALA ALA A . n A 1 67 PHE 67 129 129 PHE PHE A . n A 1 68 LEU 68 130 130 LEU LEU A . n A 1 69 LYS 69 131 131 LYS LYS A . n A 1 70 LEU 70 132 132 LEU LEU A . n A 1 71 PHE 71 133 133 PHE PHE A . n A 1 72 LEU 72 134 134 LEU LEU A . n A 1 73 GLU 73 135 135 GLU GLU A . n A 1 74 THR 74 136 136 THR THR A . n A 1 75 ALA 75 137 137 ALA ALA A . n A 1 76 GLU 76 138 138 GLU GLU A . n A 1 77 LYS 77 139 139 LYS LYS A . n A 1 78 HIS 78 140 140 HIS HIS A . n A 1 79 PHE 79 141 141 PHE PHE A . n A 1 80 MET 80 142 142 MET MET A . n A 1 81 VAL 81 143 143 VAL VAL A . n A 1 82 GLY 82 144 144 GLY GLY A . n A 1 83 HIS 83 145 145 HIS HIS A . n A 1 84 ARG 84 146 146 ARG ARG A . n A 1 85 VAL 85 147 147 VAL VAL A . n A 1 86 HIS 86 148 148 HIS HIS A . n A 1 87 TYR 87 149 149 TYR TYR A . n A 1 88 TYR 88 150 150 TYR TYR A . n A 1 89 VAL 89 151 151 VAL VAL A . n A 1 90 PHE 90 152 152 PHE PHE A . n A 1 91 THR 91 153 153 THR THR A . n A 1 92 ASP 92 154 154 ASP ASP A . n A 1 93 GLN 93 155 155 GLN GLN A . n A 1 94 PRO 94 156 156 PRO PRO A . n A 1 95 ALA 95 157 157 ALA ALA A . n A 1 96 ALA 96 158 158 ALA ALA A . n A 1 97 VAL 97 159 159 VAL VAL A . n A 1 98 PRO 98 160 160 PRO PRO A . n A 1 99 ARG 99 161 161 ARG ARG A . n A 1 100 VAL 100 162 162 VAL VAL A . n A 1 101 THR 101 163 163 THR THR A . n A 1 102 LEU 102 164 164 LEU LEU A . n A 1 103 GLY 103 165 165 GLY GLY A . n A 1 104 THR 104 166 166 THR THR A . n A 1 105 GLY 105 167 167 GLY GLY A . n A 1 106 ARG 106 168 168 ARG ARG A . n A 1 107 GLN 107 169 169 GLN GLN A . n A 1 108 LEU 108 170 170 LEU LEU A . n A 1 109 SER 109 171 171 SER SER A . n A 1 110 VAL 110 172 172 VAL VAL A . n A 1 111 LEU 111 173 173 LEU LEU A . n A 1 112 GLU 112 174 174 GLU GLU A . n A 1 113 VAL 113 175 175 VAL VAL A . n A 1 114 GLY 114 176 ? ? ? A . n A 1 115 ALA 115 177 ? ? ? A . n A 1 116 TYR 116 178 ? ? ? A . n A 1 117 LYS 117 179 ? ? ? A . n A 1 118 ARG 118 180 ? ? ? A . n A 1 119 TRP 119 181 ? ? ? A . n A 1 120 GLN 120 182 ? ? ? A . n A 1 121 ASP 121 183 ? ? ? A . n A 1 122 VAL 122 184 ? ? ? A . n A 1 123 SER 123 185 ? ? ? A . n A 1 124 MET 124 186 ? ? ? A . n A 1 125 ARG 125 187 ? ? ? A . n A 1 126 ARG 126 188 ? ? ? A . n A 1 127 MET 127 189 ? ? ? A . n A 1 128 GLU 128 190 ? ? ? A . n A 1 129 MET 129 191 ? ? ? A . n A 1 130 ILE 130 192 ? ? ? A . n A 1 131 SER 131 193 ? ? ? A . n A 1 132 ASP 132 194 ? ? ? A . n A 1 133 PHE 133 195 ? ? ? A . n A 1 134 CYS 134 196 196 CYS CYS A . n A 1 135 GLU 135 197 197 GLU GLU A . n A 1 136 ARG 136 198 198 ARG ARG A . n A 1 137 ARG 137 199 199 ARG ARG A . n A 1 138 PHE 138 200 200 PHE PHE A . n A 1 139 LEU 139 201 201 LEU LEU A . n A 1 140 SER 140 202 202 SER SER A . n A 1 141 GLU 141 203 203 GLU GLU A . n A 1 142 VAL 142 204 204 VAL VAL A . n A 1 143 ASP 143 205 205 ASP ASP A . n A 1 144 TYR 144 206 206 TYR TYR A . n A 1 145 LEU 145 207 207 LEU LEU A . n A 1 146 VAL 146 208 208 VAL VAL A . n A 1 147 CYS 147 209 209 CYS CYS A . n A 1 148 VAL 148 210 210 VAL VAL A . n A 1 149 ASP 149 211 211 ASP ASP A . n A 1 150 VAL 150 212 212 VAL VAL A . n A 1 151 ASP 151 213 213 ASP ASP A . n A 1 152 MET 152 214 214 MET MET A . n A 1 153 GLU 153 215 215 GLU GLU A . n A 1 154 PHE 154 216 216 PHE PHE A . n A 1 155 ARG 155 217 217 ARG ARG A . n A 1 156 ASP 156 218 218 ASP ASP A . n A 1 157 HIS 157 219 219 HIS HIS A . n A 1 158 VAL 158 220 220 VAL VAL A . n A 1 159 GLY 159 221 221 GLY GLY A . n A 1 160 VAL 160 222 222 VAL VAL A . n A 1 161 GLU 161 223 223 GLU GLU A . n A 1 162 ILE 162 224 224 ILE ILE A . n A 1 163 LEU 163 225 225 LEU LEU A . n A 1 164 THR 164 226 226 THR THR A . n A 1 165 PRO 165 227 227 PRO PRO A . n A 1 166 LEU 166 228 228 LEU LEU A . n A 1 167 PHE 167 229 229 PHE PHE A . n A 1 168 GLY 168 230 230 GLY GLY A . n A 1 169 THR 169 231 231 THR THR A . n A 1 170 LEU 170 232 232 LEU LEU A . n A 1 171 HIS 171 233 233 HIS HIS A . n A 1 172 PRO 172 234 234 PRO PRO A . n A 1 173 SER 173 235 235 SER SER A . n A 1 174 PHE 174 236 236 PHE PHE A . n A 1 175 TYR 175 237 237 TYR TYR A . n A 1 176 GLY 176 238 238 GLY GLY A . n A 1 177 SER 177 239 239 SER SER A . n A 1 178 SER 178 240 240 SER SER A . n A 1 179 ARG 179 241 241 ARG ARG A . n A 1 180 GLU 180 242 242 GLU GLU A . n A 1 181 ALA 181 243 243 ALA ALA A . n A 1 182 PHE 182 244 244 PHE PHE A . n A 1 183 THR 183 245 245 THR THR A . n A 1 184 TYR 184 246 246 TYR TYR A . n A 1 185 GLU 185 247 247 GLU GLU A . n A 1 186 ARG 186 248 248 ARG ARG A . n A 1 187 ARG 187 249 249 ARG ARG A . n A 1 188 PRO 188 250 250 PRO PRO A . n A 1 189 GLN 189 251 251 GLN GLN A . n A 1 190 SER 190 252 252 SER SER A . n A 1 191 GLN 191 253 253 GLN GLN A . n A 1 192 ALA 192 254 254 ALA ALA A . n A 1 193 TYR 193 255 255 TYR TYR A . n A 1 194 ILE 194 256 256 ILE ILE A . n A 1 195 PRO 195 257 257 PRO PRO A . n A 1 196 LYS 196 258 258 LYS LYS A . n A 1 197 ASP 197 259 259 ASP ASP A . n A 1 198 GLU 198 260 260 GLU GLU A . n A 1 199 GLY 199 261 261 GLY GLY A . n A 1 200 ASP 200 262 262 ASP ASP A . n A 1 201 PHE 201 263 263 PHE PHE A . n A 1 202 TYR 202 264 264 TYR TYR A . n A 1 203 TYR 203 265 265 TYR TYR A . n A 1 204 MET 204 266 266 MET MET A . n A 1 205 GLY 205 267 267 GLY GLY A . n A 1 206 ALA 206 268 268 ALA ALA A . n A 1 207 PHE 207 269 269 PHE PHE A . n A 1 208 PHE 208 270 270 PHE PHE A . n A 1 209 GLY 209 271 271 GLY GLY A . n A 1 210 GLY 210 272 272 GLY GLY A . n A 1 211 SER 211 273 273 SER SER A . n A 1 212 VAL 212 274 274 VAL VAL A . n A 1 213 GLN 213 275 275 GLN GLN A . n A 1 214 GLU 214 276 276 GLU GLU A . n A 1 215 VAL 215 277 277 VAL VAL A . n A 1 216 GLN 216 278 278 GLN GLN A . n A 1 217 ARG 217 279 279 ARG ARG A . n A 1 218 LEU 218 280 280 LEU LEU A . n A 1 219 THR 219 281 281 THR THR A . n A 1 220 ARG 220 282 282 ARG ARG A . n A 1 221 ALA 221 283 283 ALA ALA A . n A 1 222 CYS 222 284 284 CYS CYS A . n A 1 223 HIS 223 285 285 HIS HIS A . n A 1 224 GLN 224 286 286 GLN GLN A . n A 1 225 ALA 225 287 287 ALA ALA A . n A 1 226 MET 226 288 288 MET MET A . n A 1 227 MET 227 289 289 MET MET A . n A 1 228 VAL 228 290 290 VAL VAL A . n A 1 229 ASP 229 291 291 ASP ASP A . n A 1 230 GLN 230 292 292 GLN GLN A . n A 1 231 ALA 231 293 293 ALA ALA A . n A 1 232 ASN 232 294 294 ASN ASN A . n A 1 233 GLY 233 295 295 GLY GLY A . n A 1 234 ILE 234 296 296 ILE ILE A . n A 1 235 GLU 235 297 297 GLU GLU A . n A 1 236 ALA 236 298 298 ALA ALA A . n A 1 237 VAL 237 299 299 VAL VAL A . n A 1 238 TRP 238 300 300 TRP TRP A . n A 1 239 HIS 239 301 301 HIS HIS A . n A 1 240 ASP 240 302 302 ASP ASP A . n A 1 241 GLU 241 303 303 GLU GLU A . n A 1 242 SER 242 304 304 SER SER A . n A 1 243 HIS 243 305 305 HIS HIS A . n A 1 244 LEU 244 306 306 LEU LEU A . n A 1 245 ASN 245 307 307 ASN ASN A . n A 1 246 LYS 246 308 308 LYS LYS A . n A 1 247 TYR 247 309 309 TYR TYR A . n A 1 248 LEU 248 310 310 LEU LEU A . n A 1 249 LEU 249 311 311 LEU LEU A . n A 1 250 ARG 250 312 312 ARG ARG A . n A 1 251 HIS 251 313 313 HIS HIS A . n A 1 252 LYS 252 314 314 LYS LYS A . n A 1 253 PRO 253 315 315 PRO PRO A . n A 1 254 THR 254 316 316 THR THR A . n A 1 255 LYS 255 317 317 LYS LYS A . n A 1 256 VAL 256 318 318 VAL VAL A . n A 1 257 LEU 257 319 319 LEU LEU A . n A 1 258 SER 258 320 320 SER SER A . n A 1 259 PRO 259 321 321 PRO PRO A . n A 1 260 GLU 260 322 322 GLU GLU A . n A 1 261 TYR 261 323 323 TYR TYR A . n A 1 262 LEU 262 324 324 LEU LEU A . n A 1 263 TRP 263 325 325 TRP TRP A . n A 1 264 ASP 264 326 326 ASP ASP A . n A 1 265 GLN 265 327 327 GLN GLN A . n A 1 266 GLN 266 328 328 GLN GLN A . n A 1 267 LEU 267 329 329 LEU LEU A . n A 1 268 LEU 268 330 330 LEU LEU A . n A 1 269 GLY 269 331 331 GLY GLY A . n A 1 270 TRP 270 332 332 TRP TRP A . n A 1 271 PRO 271 333 333 PRO PRO A . n A 1 272 ALA 272 334 334 ALA ALA A . n A 1 273 VAL 273 335 335 VAL VAL A . n A 1 274 LEU 274 336 336 LEU LEU A . n A 1 275 ARG 275 337 337 ARG ARG A . n A 1 276 LYS 276 338 338 LYS LYS A . n A 1 277 LEU 277 339 339 LEU LEU A . n A 1 278 ARG 278 340 340 ARG ARG A . n A 1 279 PHE 279 341 341 PHE PHE A . n A 1 280 THR 280 342 342 THR THR A . n A 1 281 ALA 281 343 343 ALA ALA A . n A 1 282 VAL 282 344 344 VAL VAL A . n A 1 283 PRO 283 345 345 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GDU 1 475 475 GDU GDU A . D 4 HG 1 402 402 HG HG A . E 4 HG 1 403 403 HG HG A . F 5 HOH 1 476 1 HOH TIP A . F 5 HOH 2 477 2 HOH TIP A . F 5 HOH 3 478 3 HOH TIP A . F 5 HOH 4 479 4 HOH TIP A . F 5 HOH 5 480 5 HOH TIP A . F 5 HOH 6 481 6 HOH TIP A . F 5 HOH 7 482 7 HOH TIP A . F 5 HOH 8 483 8 HOH TIP A . F 5 HOH 9 484 9 HOH TIP A . F 5 HOH 10 485 10 HOH TIP A . F 5 HOH 11 486 11 HOH TIP A . F 5 HOH 12 487 12 HOH TIP A . F 5 HOH 13 488 13 HOH TIP A . F 5 HOH 14 489 14 HOH TIP A . F 5 HOH 15 490 15 HOH TIP A . F 5 HOH 16 491 16 HOH TIP A . F 5 HOH 17 492 17 HOH TIP A . F 5 HOH 18 493 18 HOH TIP A . F 5 HOH 19 494 19 HOH TIP A . F 5 HOH 20 495 20 HOH TIP A . F 5 HOH 21 496 21 HOH TIP A . F 5 HOH 22 497 22 HOH TIP A . F 5 HOH 23 498 23 HOH TIP A . F 5 HOH 24 499 24 HOH TIP A . F 5 HOH 25 500 25 HOH TIP A . F 5 HOH 26 501 26 HOH TIP A . F 5 HOH 27 502 27 HOH TIP A . F 5 HOH 28 503 28 HOH TIP A . F 5 HOH 29 504 29 HOH TIP A . F 5 HOH 30 505 30 HOH TIP A . F 5 HOH 31 506 31 HOH TIP A . F 5 HOH 32 507 32 HOH TIP A . F 5 HOH 33 508 33 HOH TIP A . F 5 HOH 34 509 34 HOH TIP A . F 5 HOH 35 510 35 HOH TIP A . F 5 HOH 36 511 36 HOH TIP A . F 5 HOH 37 512 37 HOH TIP A . F 5 HOH 38 513 38 HOH TIP A . F 5 HOH 39 514 39 HOH TIP A . F 5 HOH 40 515 40 HOH TIP A . F 5 HOH 41 516 41 HOH TIP A . F 5 HOH 42 517 42 HOH TIP A . F 5 HOH 43 518 43 HOH TIP A . F 5 HOH 44 519 44 HOH TIP A . F 5 HOH 45 520 45 HOH TIP A . F 5 HOH 46 521 46 HOH TIP A . F 5 HOH 47 522 47 HOH TIP A . F 5 HOH 48 523 48 HOH TIP A . F 5 HOH 49 524 49 HOH TIP A . F 5 HOH 50 525 50 HOH TIP A . F 5 HOH 51 526 51 HOH TIP A . F 5 HOH 52 527 53 HOH TIP A . F 5 HOH 53 528 54 HOH TIP A . F 5 HOH 54 529 55 HOH TIP A . F 5 HOH 55 530 56 HOH TIP A . F 5 HOH 56 531 57 HOH TIP A . F 5 HOH 57 532 58 HOH TIP A . F 5 HOH 58 533 59 HOH TIP A . F 5 HOH 59 534 60 HOH TIP A . F 5 HOH 60 535 61 HOH TIP A . F 5 HOH 61 536 62 HOH TIP A . F 5 HOH 62 537 63 HOH TIP A . F 5 HOH 63 538 64 HOH TIP A . F 5 HOH 64 539 65 HOH TIP A . F 5 HOH 65 540 66 HOH TIP A . F 5 HOH 66 541 67 HOH TIP A . F 5 HOH 67 542 68 HOH TIP A . F 5 HOH 68 543 69 HOH TIP A . F 5 HOH 69 544 70 HOH TIP A . F 5 HOH 70 545 71 HOH TIP A . F 5 HOH 71 546 72 HOH TIP A . F 5 HOH 72 547 73 HOH TIP A . F 5 HOH 73 548 74 HOH TIP A . F 5 HOH 74 549 75 HOH TIP A . F 5 HOH 75 550 76 HOH TIP A . F 5 HOH 76 551 77 HOH TIP A . F 5 HOH 77 552 78 HOH TIP A . F 5 HOH 78 553 79 HOH TIP A . F 5 HOH 79 554 80 HOH TIP A . F 5 HOH 80 555 81 HOH TIP A . F 5 HOH 81 556 82 HOH TIP A . F 5 HOH 82 557 83 HOH TIP A . F 5 HOH 83 558 84 HOH TIP A . F 5 HOH 84 559 85 HOH TIP A . F 5 HOH 85 560 86 HOH TIP A . F 5 HOH 86 561 87 HOH TIP A . F 5 HOH 87 562 88 HOH TIP A . F 5 HOH 88 563 89 HOH TIP A . F 5 HOH 89 564 90 HOH TIP A . F 5 HOH 90 565 91 HOH TIP A . F 5 HOH 91 566 92 HOH TIP A . F 5 HOH 92 567 93 HOH TIP A . F 5 HOH 93 568 94 HOH TIP A . F 5 HOH 94 569 95 HOH TIP A . F 5 HOH 95 570 96 HOH TIP A . F 5 HOH 96 571 97 HOH TIP A . F 5 HOH 97 572 98 HOH TIP A . F 5 HOH 98 573 99 HOH TIP A . F 5 HOH 99 574 100 HOH TIP A . F 5 HOH 100 575 101 HOH TIP A . F 5 HOH 101 576 102 HOH TIP A . F 5 HOH 102 577 103 HOH TIP A . F 5 HOH 103 578 104 HOH TIP A . F 5 HOH 104 579 105 HOH TIP A . F 5 HOH 105 580 106 HOH TIP A . F 5 HOH 106 581 107 HOH TIP A . F 5 HOH 107 582 108 HOH TIP A . F 5 HOH 108 583 109 HOH TIP A . F 5 HOH 109 584 110 HOH TIP A . F 5 HOH 110 585 111 HOH TIP A . F 5 HOH 111 586 112 HOH TIP A . F 5 HOH 112 587 113 HOH TIP A . F 5 HOH 113 588 114 HOH TIP A . F 5 HOH 114 589 115 HOH TIP A . F 5 HOH 115 590 116 HOH TIP A . F 5 HOH 116 591 117 HOH TIP A . F 5 HOH 117 592 118 HOH TIP A . F 5 HOH 118 593 119 HOH TIP A . F 5 HOH 119 594 120 HOH TIP A . F 5 HOH 120 595 121 HOH TIP A . F 5 HOH 121 596 122 HOH TIP A . F 5 HOH 122 597 123 HOH TIP A . F 5 HOH 123 598 124 HOH TIP A . F 5 HOH 124 599 125 HOH TIP A . F 5 HOH 125 600 126 HOH TIP A . F 5 HOH 126 601 127 HOH TIP A . F 5 HOH 127 602 128 HOH TIP A . F 5 HOH 128 603 129 HOH TIP A . F 5 HOH 129 604 130 HOH TIP A . F 5 HOH 130 605 131 HOH TIP A . F 5 HOH 131 606 132 HOH TIP A . F 5 HOH 132 607 133 HOH TIP A . F 5 HOH 133 608 134 HOH TIP A . F 5 HOH 134 609 135 HOH TIP A . F 5 HOH 135 610 136 HOH TIP A . F 5 HOH 136 611 137 HOH TIP A . F 5 HOH 137 612 138 HOH TIP A . F 5 HOH 138 613 139 HOH TIP A . F 5 HOH 139 614 140 HOH TIP A . F 5 HOH 140 615 141 HOH TIP A . F 5 HOH 141 616 142 HOH TIP A . F 5 HOH 142 617 143 HOH TIP A . F 5 HOH 143 618 144 HOH TIP A . F 5 HOH 144 619 145 HOH TIP A . F 5 HOH 145 620 146 HOH TIP A . F 5 HOH 146 621 147 HOH TIP A . F 5 HOH 147 622 148 HOH TIP A . F 5 HOH 148 623 149 HOH TIP A . F 5 HOH 149 624 150 HOH TIP A . F 5 HOH 150 625 151 HOH TIP A . F 5 HOH 151 626 152 HOH TIP A . F 5 HOH 152 627 153 HOH TIP A . F 5 HOH 153 628 154 HOH TIP A . F 5 HOH 154 629 155 HOH TIP A . F 5 HOH 155 630 156 HOH TIP A . F 5 HOH 156 631 157 HOH TIP A . F 5 HOH 157 632 158 HOH TIP A . F 5 HOH 158 633 159 HOH TIP A . F 5 HOH 159 634 160 HOH TIP A . F 5 HOH 160 635 161 HOH TIP A . F 5 HOH 161 636 162 HOH TIP A . F 5 HOH 162 637 163 HOH TIP A . F 5 HOH 163 638 165 HOH TIP A . F 5 HOH 164 639 166 HOH TIP A . F 5 HOH 165 640 167 HOH TIP A . F 5 HOH 166 641 168 HOH TIP A . F 5 HOH 167 642 169 HOH TIP A . F 5 HOH 168 643 170 HOH TIP A . F 5 HOH 169 644 171 HOH TIP A . F 5 HOH 170 645 172 HOH TIP A . F 5 HOH 171 646 173 HOH TIP A . F 5 HOH 172 647 174 HOH TIP A . F 5 HOH 173 648 175 HOH TIP A . F 5 HOH 174 649 176 HOH TIP A . F 5 HOH 175 650 177 HOH TIP A . F 5 HOH 176 651 178 HOH TIP A . F 5 HOH 177 652 179 HOH TIP A . F 5 HOH 178 653 180 HOH TIP A . F 5 HOH 179 654 181 HOH TIP A . F 5 HOH 180 655 182 HOH TIP A . F 5 HOH 181 656 183 HOH TIP A . F 5 HOH 182 657 184 HOH TIP A . F 5 HOH 183 658 185 HOH TIP A . F 5 HOH 184 659 186 HOH TIP A . F 5 HOH 185 660 187 HOH TIP A . F 5 HOH 186 661 188 HOH TIP A . F 5 HOH 187 662 189 HOH TIP A . F 5 HOH 188 663 190 HOH TIP A . F 5 HOH 189 664 191 HOH TIP A . F 5 HOH 190 665 192 HOH TIP A . F 5 HOH 191 666 193 HOH TIP A . F 5 HOH 192 667 194 HOH TIP A . F 5 HOH 193 668 195 HOH TIP A . F 5 HOH 194 669 196 HOH TIP A . F 5 HOH 195 670 198 HOH TIP A . F 5 HOH 196 671 199 HOH TIP A . F 5 HOH 197 672 200 HOH TIP A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA,PQS dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1,2 A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 8280 ? 2 MORE -107 ? 2 'SSA (A^2)' 22450 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_655 -x+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 52.8000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 39.7500000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG1 ? A THR 57 ? A THR 119 ? 1_555 HG ? E HG . ? A HG 403 ? 1_555 SG ? A CYS 147 ? A CYS 209 ? 1_555 91.1 ? 2 OG1 ? A THR 57 ? A THR 119 ? 1_555 HG ? E HG . ? A HG 403 ? 1_555 O ? F HOH . ? A HOH 660 ? 1_555 101.3 ? 3 SG ? A CYS 147 ? A CYS 209 ? 1_555 HG ? E HG . ? A HG 403 ? 1_555 O ? F HOH . ? A HOH 660 ? 1_555 88.6 ? 4 OG1 ? A THR 57 ? A THR 119 ? 1_555 HG ? E HG . ? A HG 403 ? 1_555 O ? F HOH . ? A HOH 666 ? 1_555 99.0 ? 5 SG ? A CYS 147 ? A CYS 209 ? 1_555 HG ? E HG . ? A HG 403 ? 1_555 O ? F HOH . ? A HOH 666 ? 1_555 168.3 ? 6 O ? F HOH . ? A HOH 660 ? 1_555 HG ? E HG . ? A HG 403 ? 1_555 O ? F HOH . ? A HOH 666 ? 1_555 95.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-02-10 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 5 'Structure model' 2 1 2022-12-21 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' entity 4 4 'Structure model' pdbx_branch_scheme 5 4 'Structure model' pdbx_chem_comp_identifier 6 4 'Structure model' pdbx_entity_branch 7 4 'Structure model' pdbx_entity_branch_descriptor 8 4 'Structure model' pdbx_entity_branch_link 9 4 'Structure model' pdbx_entity_branch_list 10 4 'Structure model' pdbx_entity_nonpoly 11 4 'Structure model' pdbx_nonpoly_scheme 12 4 'Structure model' pdbx_struct_assembly_gen 13 4 'Structure model' pdbx_struct_conn_angle 14 4 'Structure model' struct_asym 15 4 'Structure model' struct_conn 16 4 'Structure model' struct_site 17 4 'Structure model' struct_site_gen 18 5 'Structure model' chem_comp 19 5 'Structure model' database_2 20 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.auth_asym_id' 2 4 'Structure model' '_atom_site.auth_seq_id' 3 4 'Structure model' '_atom_site.label_asym_id' 4 4 'Structure model' '_atom_site.label_entity_id' 5 4 'Structure model' '_chem_comp.name' 6 4 'Structure model' '_chem_comp.type' 7 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.value' 22 4 'Structure model' '_struct_conn.pdbx_dist_value' 23 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 24 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 25 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 26 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 29 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 30 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 31 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 32 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 33 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 35 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 36 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 37 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 38 5 'Structure model' '_chem_comp.pdbx_synonyms' 39 5 'Structure model' '_database_2.pdbx_DOI' 40 5 'Structure model' '_database_2.pdbx_database_accession' 41 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.location _software.classification _software.language _software.citation_id _software.pdbx_ordinal CNS 1.1 1998 package 'Axel T. Brunger' axel.brunger@yale.edu . refinement Fortran ? 1 HKL-2000 . ? ? ? ? ? 'data reduction' ? ? 2 SCALEPACK . ? ? ? ? ? 'data scaling' ? ? 3 CNS 1.1 ? ? ? ? ? phasing ? ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 124 ? ? 55.84 -131.23 2 1 THR A 245 ? ? -84.70 47.78 3 1 PHE A 269 ? ? -161.58 104.07 4 1 HIS A 301 ? ? 47.03 -128.92 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A GDU 475 ? "C1'" ? C GDU 1 "C1'" 2 1 N 1 A GDU 475 ? "C2'" ? C GDU 1 "C2'" 3 1 N 1 A GDU 475 ? "C3'" ? C GDU 1 "C3'" 4 1 N 1 A GDU 475 ? "C4'" ? C GDU 1 "C4'" 5 1 N 1 A GDU 475 ? "C5'" ? C GDU 1 "C5'" 6 1 N 1 A GDU 475 ? "C6'" ? C GDU 1 "C6'" 7 1 N 1 A GDU 475 ? "O2'" ? C GDU 1 "O2'" 8 1 N 1 A GDU 475 ? "O3'" ? C GDU 1 "O3'" 9 1 N 1 A GDU 475 ? "O4'" ? C GDU 1 "O4'" 10 1 N 1 A GDU 475 ? "O5'" ? C GDU 1 "O5'" 11 1 N 1 A GDU 475 ? "O6'" ? C GDU 1 "O6'" # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 176 ? A GLY 114 2 1 Y 1 A ALA 177 ? A ALA 115 3 1 Y 1 A TYR 178 ? A TYR 116 4 1 Y 1 A LYS 179 ? A LYS 117 5 1 Y 1 A ARG 180 ? A ARG 118 6 1 Y 1 A TRP 181 ? A TRP 119 7 1 Y 1 A GLN 182 ? A GLN 120 8 1 Y 1 A ASP 183 ? A ASP 121 9 1 Y 1 A VAL 184 ? A VAL 122 10 1 Y 1 A SER 185 ? A SER 123 11 1 Y 1 A MET 186 ? A MET 124 12 1 Y 1 A ARG 187 ? A ARG 125 13 1 Y 1 A ARG 188 ? A ARG 126 14 1 Y 1 A MET 189 ? A MET 127 15 1 Y 1 A GLU 190 ? A GLU 128 16 1 Y 1 A MET 191 ? A MET 129 17 1 Y 1 A ILE 192 ? A ILE 130 18 1 Y 1 A SER 193 ? A SER 131 19 1 Y 1 A ASP 194 ? A ASP 132 20 1 Y 1 A PHE 195 ? A PHE 133 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 AOG 1 B AOG 1 B AOG 452 n B 2 FUC 2 B FUC 2 B FUC 453 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 LFucpa FUC 'COMMON NAME' GMML 1.0 a-L-fucopyranose FUC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-Fucp FUC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fuc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'WURCS=2.0/2,2,1/[a2112h-1b_1-5_1*OCCCCCCCC_3*N][a1221m-1a_1-5]/1-2/a2-b1' WURCS PDB2Glycan 1.1.0 2 2 '[][octyl]{[(1+1)][b-D-Galp3N]{[(2+1)][a-L-Fucp]{}}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 FUC _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 AOG _pdbx_entity_branch_link.atom_id_2 O2 _pdbx_entity_branch_link.leaving_atom_id_2 HO2 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 AOG 1 n 2 FUC 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 "GALACTOSE-URIDINE-5'-DIPHOSPHATE" GDU 4 'MERCURY (II) ION' HG 5 water HOH #