data_1RCL # _entry.id 1RCL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1RCL WWPDB D_1000176019 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1RCK _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RCL _pdbx_database_status.recvd_initial_deposition_date 1994-08-08 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nakai, T.' 1 'Yoshikawa, W.' 2 'Nakamura, H.' 3 'Yoshida, H.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;The three-dimensional structure of guanine-specific ribonuclease F1 in solution determined by NMR spectroscopy and distance geometry. ; Eur.J.Biochem. 208 41 51 1992 EJBCAI IX 0014-2956 0262 ? 1511688 10.1111/j.1432-1033.1992.tb17157.x 1 ;Accurate Determination of Protein Conformations by Nuclear Magnetic Resonance Spectroscopy and Distance Geometry and Analysis of Their Structural Features ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 2 ;Crystal Structures of Ribonuclease F1 of Fusarium Moniliforme in its Free Form and in Complex with 2'Gmp ; J.Mol.Biol. 230 979 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nakai, T.' 1 ? primary 'Yoshikawa, W.' 2 ? primary 'Nakamura, H.' 3 ? primary 'Yoshida, H.' 4 ? 1 'Nakai, T.' 5 ? 2 'Vassylyev, D.G.' 6 ? 2 'Katayanagi, K.' 7 ? 2 'Ishikawa, K.' 8 ? 2 'Tsujimoto-Hirano, M.' 9 ? 2 'Danno, M.' 10 ? 2 'Pahler, A.' 11 ? 2 'Matsumoto, O.' 12 ? 2 'Matsushima, M.' 13 ? 2 'Yoshida, H.' 14 ? 2 'Morikawa, K.' 15 ? # _cell.entry_id 1RCL _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RCL _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RIBONUCLEASE F1' _entity.formula_weight 10989.544 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.27.3 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(PCA)SATTCGSTNYSASQVRAAANAACQYYQNDDTAGSSTYPHTYNNYEGFDFPVDGPYQEFPIKSGGVYTGGSPGADR VVINTNCEYAGAITHTGASGNNFVGCSGTN ; _entity_poly.pdbx_seq_one_letter_code_can ;QSATTCGSTNYSASQVRAAANAACQYYQNDDTAGSSTYPHTYNNYEGFDFPVDGPYQEFPIKSGGVYTGGSPGADRVVIN TNCEYAGAITHTGASGNNFVGCSGTN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 SER n 1 3 ALA n 1 4 THR n 1 5 THR n 1 6 CYS n 1 7 GLY n 1 8 SER n 1 9 THR n 1 10 ASN n 1 11 TYR n 1 12 SER n 1 13 ALA n 1 14 SER n 1 15 GLN n 1 16 VAL n 1 17 ARG n 1 18 ALA n 1 19 ALA n 1 20 ALA n 1 21 ASN n 1 22 ALA n 1 23 ALA n 1 24 CYS n 1 25 GLN n 1 26 TYR n 1 27 TYR n 1 28 GLN n 1 29 ASN n 1 30 ASP n 1 31 ASP n 1 32 THR n 1 33 ALA n 1 34 GLY n 1 35 SER n 1 36 SER n 1 37 THR n 1 38 TYR n 1 39 PRO n 1 40 HIS n 1 41 THR n 1 42 TYR n 1 43 ASN n 1 44 ASN n 1 45 TYR n 1 46 GLU n 1 47 GLY n 1 48 PHE n 1 49 ASP n 1 50 PHE n 1 51 PRO n 1 52 VAL n 1 53 ASP n 1 54 GLY n 1 55 PRO n 1 56 TYR n 1 57 GLN n 1 58 GLU n 1 59 PHE n 1 60 PRO n 1 61 ILE n 1 62 LYS n 1 63 SER n 1 64 GLY n 1 65 GLY n 1 66 VAL n 1 67 TYR n 1 68 THR n 1 69 GLY n 1 70 GLY n 1 71 SER n 1 72 PRO n 1 73 GLY n 1 74 ALA n 1 75 ASP n 1 76 ARG n 1 77 VAL n 1 78 VAL n 1 79 ILE n 1 80 ASN n 1 81 THR n 1 82 ASN n 1 83 CYS n 1 84 GLU n 1 85 TYR n 1 86 ALA n 1 87 GLY n 1 88 ALA n 1 89 ILE n 1 90 THR n 1 91 HIS n 1 92 THR n 1 93 GLY n 1 94 ALA n 1 95 SER n 1 96 GLY n 1 97 ASN n 1 98 ASN n 1 99 PHE n 1 100 VAL n 1 101 GLY n 1 102 CYS n 1 103 SER n 1 104 GLY n 1 105 THR n 1 106 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Gibberella _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gibberella fujikuroi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5127 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNF1_GIBFU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P10282 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;QSATTCGSTNYSASQVRAAANAACQYYQNDDSAGSTTYPHTYNNYEGFDFPVDGPYQEFPIKSGGVYTGGSPGADRVVIN TNCEYAGAITHTGASGNNFVGCSGTN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RCL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10282 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 106 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1RCL THR A 32 ? UNP P10282 SER 32 conflict 32 1 1 1RCL SER A 36 ? UNP P10282 THR 36 conflict 36 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1RCL _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement EMBOSS ? NAKAI,KIDERA,NAKAMURA 1 refinement PRESTO ? MORIKAMI,NAKAI,KIDERA,SAITO,NAKAMURA 2 # _exptl.entry_id 1RCL _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1RCL _struct.title ;THE THREE DIMENSIONAL STRUCTURE OF GUANINE-SPECIFIC RIBONUCLEASE F1 IN SOLUTION DETERMINED BY NMR SPECTROSCOPY AND DISTANCE GEOMETRY ; _struct.pdbx_descriptor 'RIBONUCLEASE F1 (E.C.3.1.27.3) (NMR, MINIMIZED AVERAGE STRUCTURE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RCL _struct_keywords.pdbx_keywords 'HYDROLASE(ENDORIBONUCLEASE)' _struct_keywords.text 'HYDROLASE(ENDORIBONUCLEASE)' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 29 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 102 SG ? ? A CYS 6 A CYS 102 1_555 ? ? ? ? ? ? ? 2.044 ? disulf2 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 83 SG ? ? A CYS 24 A CYS 83 1_555 ? ? ? ? ? ? ? 2.045 ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A SER 2 N ? ? A PCA 1 A SER 2 1_555 ? ? ? ? ? ? ? 1.341 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 38 A . ? TYR 38 A PRO 39 A ? PRO 39 A 1 3.04 2 GLY 54 A . ? GLY 54 A PRO 55 A ? PRO 55 A 1 -1.04 3 SER 71 A . ? SER 71 A PRO 72 A ? PRO 72 A 1 -4.00 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 2 ? S2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S2 1 2 ? anti-parallel S2 2 3 ? anti-parallel S2 3 4 ? anti-parallel S2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 THR A 4 ? CYS A 6 ? THR A 4 CYS A 6 S1 2 THR A 9 ? TYR A 11 ? THR A 9 TYR A 11 S2 1 PRO A 39 ? TYR A 42 ? PRO A 39 TYR A 42 S2 2 TYR A 56 ? ILE A 61 ? TYR A 56 ILE A 61 S2 3 ASP A 75 ? ASN A 80 ? ASP A 75 ASN A 80 S2 4 GLU A 84 ? HIS A 91 ? GLU A 84 HIS A 91 S2 5 PHE A 99 ? CYS A 102 ? PHE A 99 CYS A 102 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 N THR A 4 ? N THR A 4 O TYR A 11 ? O TYR A 11 S2 1 2 N TYR A 42 ? N TYR A 42 O TYR A 56 ? O TYR A 56 S2 2 3 N GLN A 57 ? N GLN A 57 O ILE A 79 ? O ILE A 79 S2 3 4 N ARG A 76 ? N ARG A 76 O ILE A 89 ? O ILE A 89 S2 4 5 N ALA A 88 ? N ALA A 88 O CYS A 102 ? O CYS A 102 # _struct_site.id CAT _struct_site.pdbx_evidence_code Unknown _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details ? # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAT 4 HIS A 40 ? HIS A 40 . ? 1_555 ? 2 CAT 4 GLU A 58 ? GLU A 58 . ? 1_555 ? 3 CAT 4 ARG A 76 ? ARG A 76 . ? 1_555 ? 4 CAT 4 HIS A 91 ? HIS A 91 . ? 1_555 ? # _database_PDB_matrix.entry_id 1RCL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RCL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'CIS PROLINE - PRO 39' 2 'CIS PROLINE - PRO 55' 3 'CIS PROLINE - PRO 72' # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 ASN 106 106 106 ASN ASN A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'PYROGLUTAMIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-11-30 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 2 0 2019-12-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Polymer sequence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type 6 5 'Structure model' entity_poly 7 5 'Structure model' pdbx_struct_mod_residue 8 5 'Structure model' struct_conn 9 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 3 5 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id' 4 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 3 ? ? 57.66 84.71 2 1 ASN A 29 ? ? -176.51 37.80 3 1 ASP A 31 ? ? 89.63 157.00 4 1 ALA A 33 ? ? -61.26 93.84 5 1 SER A 35 ? ? 71.99 133.92 6 1 THR A 37 ? ? -147.19 -32.04 7 1 ASN A 44 ? ? 32.72 -156.62 8 1 TYR A 45 ? ? 67.44 151.35 9 1 VAL A 52 ? ? -146.58 -114.75 10 1 ASP A 53 ? ? -157.89 -56.09 11 1 PHE A 59 ? ? -160.21 102.57 12 1 TYR A 67 ? ? -3.67 118.24 13 1 THR A 68 ? ? -122.61 -51.19 14 1 SER A 71 ? ? 81.80 135.34 15 1 ASN A 82 ? ? -157.36 -86.45 16 1 CYS A 83 ? ? -163.22 5.16 17 1 ASN A 98 ? ? -66.41 -178.45 #