data_1RFE # _entry.id 1RFE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.307 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1RFE RCSB RCSB020697 WWPDB D_1000020697 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id Rv2991 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RFE _pdbx_database_status.recvd_initial_deposition_date 2003-11-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Benini, S.' 1 'Haouz, A.' 2 'Proux, F.' 3 'Betton, J.M.' 4 'Alzari, P.' 5 'Dodson, G.G.' 6 'Wilson, K.S.' 7 'TB Structural Genomics Consortium (TBSGC)' 8 # _citation.id primary _citation.title 'The crystal structure of Rv2991 from Mycobacterium tuberculosis: An F420binding protein with unknown function.' _citation.journal_abbrev 'J. Struct. Biol.' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2019 _citation.journal_id_ASTM JSBIEM _citation.country US _citation.journal_id_ISSN 1095-8657 _citation.journal_id_CSD 0803 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 30890426 _citation.pdbx_database_id_DOI 10.1016/j.jsb.2019.03.006 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Benini, S.' 1 ? primary 'Haouz, A.' 2 ? primary 'Proux, F.' 3 ? primary 'Alzari, P.' 4 ? primary 'Wilson, K.' 5 ? # _cell.entry_id 1RFE _cell.length_a 49.309 _cell.length_b 49.309 _cell.length_c 132.588 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RFE _symmetry.space_group_name_H-M 'P 43 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 95 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'hypothetical protein Rv2991' 18394.855 1 ? ? ? ? 2 water nat water 18.015 125 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GTKQRADIV(MSE)SEAEIADFVNSSRTGTLATIGPDGQPHLTA(MSE)WYAVIDGEIWLETKAKSQKAVNLRRDPRVSF LLEDGDTYDTLRGVSFEGVAEIVEEPEALHRVGVSVWERYTGPYTDE(CSX)KP(MSE)VDQ(MSE)(MSE)NKRVGVRI VARRTRSWDHRKLGLPH(MSE)SVGGSTAP ; _entity_poly.pdbx_seq_one_letter_code_can ;GTKQRADIVMSEAEIADFVNSSRTGTLATIGPDGQPHLTAMWYAVIDGEIWLETKAKSQKAVNLRRDPRVSFLLEDGDTY DTLRGVSFEGVAEIVEEPEALHRVGVSVWERYTGPYTDECKPMVDQMMNKRVGVRIVARRTRSWDHRKLGLPHMSVGGST AP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier Rv2991 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 LYS n 1 4 GLN n 1 5 ARG n 1 6 ALA n 1 7 ASP n 1 8 ILE n 1 9 VAL n 1 10 MSE n 1 11 SER n 1 12 GLU n 1 13 ALA n 1 14 GLU n 1 15 ILE n 1 16 ALA n 1 17 ASP n 1 18 PHE n 1 19 VAL n 1 20 ASN n 1 21 SER n 1 22 SER n 1 23 ARG n 1 24 THR n 1 25 GLY n 1 26 THR n 1 27 LEU n 1 28 ALA n 1 29 THR n 1 30 ILE n 1 31 GLY n 1 32 PRO n 1 33 ASP n 1 34 GLY n 1 35 GLN n 1 36 PRO n 1 37 HIS n 1 38 LEU n 1 39 THR n 1 40 ALA n 1 41 MSE n 1 42 TRP n 1 43 TYR n 1 44 ALA n 1 45 VAL n 1 46 ILE n 1 47 ASP n 1 48 GLY n 1 49 GLU n 1 50 ILE n 1 51 TRP n 1 52 LEU n 1 53 GLU n 1 54 THR n 1 55 LYS n 1 56 ALA n 1 57 LYS n 1 58 SER n 1 59 GLN n 1 60 LYS n 1 61 ALA n 1 62 VAL n 1 63 ASN n 1 64 LEU n 1 65 ARG n 1 66 ARG n 1 67 ASP n 1 68 PRO n 1 69 ARG n 1 70 VAL n 1 71 SER n 1 72 PHE n 1 73 LEU n 1 74 LEU n 1 75 GLU n 1 76 ASP n 1 77 GLY n 1 78 ASP n 1 79 THR n 1 80 TYR n 1 81 ASP n 1 82 THR n 1 83 LEU n 1 84 ARG n 1 85 GLY n 1 86 VAL n 1 87 SER n 1 88 PHE n 1 89 GLU n 1 90 GLY n 1 91 VAL n 1 92 ALA n 1 93 GLU n 1 94 ILE n 1 95 VAL n 1 96 GLU n 1 97 GLU n 1 98 PRO n 1 99 GLU n 1 100 ALA n 1 101 LEU n 1 102 HIS n 1 103 ARG n 1 104 VAL n 1 105 GLY n 1 106 VAL n 1 107 SER n 1 108 VAL n 1 109 TRP n 1 110 GLU n 1 111 ARG n 1 112 TYR n 1 113 THR n 1 114 GLY n 1 115 PRO n 1 116 TYR n 1 117 THR n 1 118 ASP n 1 119 GLU n 1 120 CSX n 1 121 LYS n 1 122 PRO n 1 123 MSE n 1 124 VAL n 1 125 ASP n 1 126 GLN n 1 127 MSE n 1 128 MSE n 1 129 ASN n 1 130 LYS n 1 131 ARG n 1 132 VAL n 1 133 GLY n 1 134 VAL n 1 135 ARG n 1 136 ILE n 1 137 VAL n 1 138 ALA n 1 139 ARG n 1 140 ARG n 1 141 THR n 1 142 ARG n 1 143 SER n 1 144 TRP n 1 145 ASP n 1 146 HIS n 1 147 ARG n 1 148 LYS n 1 149 LEU n 1 150 GLY n 1 151 LEU n 1 152 PRO n 1 153 HIS n 1 154 MSE n 1 155 SER n 1 156 VAL n 1 157 GLY n 1 158 GLY n 1 159 SER n 1 160 THR n 1 161 ALA n 1 162 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Mycobacterium _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Mycobacterium tuberculosis' _entity_src_gen.gene_src_strain H37Rv _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pdest17 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O53240_MYCTU _struct_ref.pdbx_db_accession O53240 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GTKQRADIVMSEAEIADFVNSSRTGTLATIGPDGQPHLTAMWYAVIDGEIWLETKAKSQKAVNLRRDPRVSFLLEDGDTY DTLRGVSFEGVAEIVEEPEALHRVGVSVWERYTGPYTDECKPMVDQMMNKRVGVRIVARRTRSWDHRKLGLPHMSVGGST AP ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RFE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O53240 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 163 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 163 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1RFE MSE A 10 ? UNP O53240 MET 11 'MODIFIED RESIDUE' 11 1 1 1RFE MSE A 41 ? UNP O53240 MET 42 'MODIFIED RESIDUE' 42 2 1 1RFE CSX A 120 ? UNP O53240 CYS 121 'MODIFIED RESIDUE' 121 3 1 1RFE MSE A 123 ? UNP O53240 MET 124 'MODIFIED RESIDUE' 124 4 1 1RFE MSE A 127 ? UNP O53240 MET 128 'MODIFIED RESIDUE' 128 5 1 1RFE MSE A 128 ? UNP O53240 MET 129 'MODIFIED RESIDUE' 129 6 1 1RFE MSE A 154 ? UNP O53240 MET 155 'MODIFIED RESIDUE' 155 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSX 'L-peptide linking' n 'S-OXY CYSTEINE' ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1RFE _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 44.7 _exptl_crystal.description ? _exptl_crystal.density_Matthews 2.2 _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pdbx_details '25% PEG 4000 , pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 290K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2003-06-26 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator silicon _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.979 # _reflns.entry_id 1RFE _reflns.observed_criterion_sigma_F 2.000 _reflns.observed_criterion_sigma_I 2.000 _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 49.39 _reflns.number_all 127485 _reflns.number_obs 127155 _reflns.percent_possible_obs 98.8 _reflns.pdbx_Rmerge_I_obs 0.177 _reflns.pdbx_Rsym_value 0.177 _reflns.pdbx_netI_over_sigmaI 11.68 _reflns.B_iso_Wilson_estimate 24.418 _reflns.pdbx_redundancy 10.87 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.03 _reflns_shell.percent_possible_all 76.7 _reflns_shell.Rmerge_I_obs 0.79 _reflns_shell.pdbx_Rsym_value 0.79 _reflns_shell.meanI_over_sigI_obs 1.23 _reflns_shell.pdbx_redundancy 2.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1142 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1RFE _refine.ls_number_reflns_obs 10829 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 49.39 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 97.31 _refine.ls_R_factor_obs 0.20572 _refine.ls_R_factor_all 0.20572 _refine.ls_R_factor_R_work 0.20213 _refine.ls_R_factor_R_free 0.28106 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 542 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.897 _refine.B_iso_mean 25.358 _refine.aniso_B[1][1] 1.32 _refine.aniso_B[2][2] 1.32 _refine.aniso_B[3][3] -2.64 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.212 _refine.pdbx_overall_ESU_R_Free 0.206 _refine.overall_SU_ML 0.139 _refine.overall_SU_B 5.071 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1237 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 125 _refine_hist.number_atoms_total 1362 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 49.39 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.020 0.021 ? 1282 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 1173 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.689 1.938 ? 1738 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.407 3.000 ? 2705 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.052 5.000 ? 161 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_chiral_restr 0.108 0.200 ? 192 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 1438 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.003 0.020 ? 272 'X-RAY DIFFRACTION' ? r_nbd_refined 0.218 0.200 ? 377 'X-RAY DIFFRACTION' ? r_nbd_other 0.263 0.200 ? 1394 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other 0.151 0.200 ? 1103 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.223 0.200 ? 74 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.172 0.200 ? 32 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.307 0.200 ? 61 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.212 0.200 ? 11 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.011 1.500 ? 799 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.795 2.000 ? 1291 'X-RAY DIFFRACTION' ? r_scbond_it 3.114 3.000 ? 483 'X-RAY DIFFRACTION' ? r_scangle_it 5.059 4.500 ? 447 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.004 _refine_ls_shell.d_res_low 2.056 _refine_ls_shell.number_reflns_R_work 611 _refine_ls_shell.R_factor_R_work 0.23 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.301 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 34 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1RFE _struct.title 'Crystal structure of conserved hypothetical protein Rv2991 from Mycobacterium tuberculosis' _struct.pdbx_descriptor 'hypothetical protein Rv2991' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RFE _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;STRUCTURAL GENOMICS, TB, Mycobacterium tuberculosis, FMN binding, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 11 ? SER A 22 ? SER A 12 SER A 23 1 ? 12 HELX_P HELX_P2 2 SER A 58 ? ASP A 67 ? SER A 59 ASP A 68 1 ? 10 HELX_P HELX_P3 3 THR A 79 ? THR A 82 ? THR A 80 THR A 83 5 ? 4 HELX_P HELX_P4 4 GLU A 97 ? THR A 113 ? GLU A 98 THR A 114 1 ? 17 HELX_P HELX_P5 5 THR A 117 ? GLU A 119 ? THR A 118 GLU A 120 5 ? 3 HELX_P HELX_P6 6 CSX A 120 ? MSE A 128 ? CSX A 121 MSE A 129 1 ? 9 HELX_P HELX_P7 7 ARG A 147 ? GLY A 150 ? ARG A 148 GLY A 151 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A VAL 9 C ? ? ? 1_555 A MSE 10 N ? ? A VAL 10 A MSE 11 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale both ? A MSE 10 C ? ? ? 1_555 A SER 11 N ? ? A MSE 11 A SER 12 1_555 ? ? ? ? ? ? ? 1.327 ? covale3 covale both ? A ALA 40 C ? ? ? 1_555 A MSE 41 N ? ? A ALA 41 A MSE 42 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale both ? A MSE 41 C ? ? ? 1_555 A TRP 42 N ? ? A MSE 42 A TRP 43 1_555 ? ? ? ? ? ? ? 1.334 ? covale5 covale both ? A GLU 119 C ? ? ? 1_555 A CSX 120 N ? ? A GLU 120 A CSX 121 1_555 ? ? ? ? ? ? ? 1.337 ? covale6 covale both ? A CSX 120 C ? ? ? 1_555 A LYS 121 N ? ? A CSX 121 A LYS 122 1_555 ? ? ? ? ? ? ? 1.346 ? covale7 covale both ? A PRO 122 C ? ? ? 1_555 A MSE 123 N ? ? A PRO 123 A MSE 124 1_555 ? ? ? ? ? ? ? 1.318 ? covale8 covale both ? A MSE 123 C ? ? ? 1_555 A VAL 124 N ? ? A MSE 124 A VAL 125 1_555 ? ? ? ? ? ? ? 1.313 ? covale9 covale both ? A GLN 126 C ? ? ? 1_555 A MSE 127 N ? ? A GLN 127 A MSE 128 1_555 ? ? ? ? ? ? ? 1.314 ? covale10 covale both ? A MSE 127 C ? ? ? 1_555 A MSE 128 N ? ? A MSE 128 A MSE 129 1_555 ? ? ? ? ? ? ? 1.322 ? covale11 covale both ? A MSE 128 C ? ? ? 1_555 A ASN 129 N ? ? A MSE 129 A ASN 130 1_555 ? ? ? ? ? ? ? 1.332 ? covale12 covale both ? A HIS 153 C ? ? ? 1_555 A MSE 154 N ? ? A HIS 154 A MSE 155 1_555 ? ? ? ? ? ? ? 1.331 ? covale13 covale both ? A MSE 154 C ? ? ? 1_555 A SER 155 N ? ? A MSE 155 A SER 156 1_555 ? ? ? ? ? ? ? 1.319 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PRO A 36 ? MSE A 41 ? PRO A 37 MSE A 42 A 2 GLY A 25 ? ILE A 30 ? GLY A 26 ILE A 31 A 3 ARG A 69 ? ASP A 76 ? ARG A 70 ASP A 77 A 4 ARG A 84 ? VAL A 95 ? ARG A 85 VAL A 96 A 5 ARG A 131 ? ASP A 145 ? ARG A 132 ASP A 146 A 6 GLU A 49 ? LYS A 55 ? GLU A 50 LYS A 56 A 7 ALA A 44 ? ILE A 46 ? ALA A 45 ILE A 47 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 37 ? O HIS A 38 N THR A 29 ? N THR A 30 A 2 3 N ALA A 28 ? N ALA A 29 O SER A 71 ? O SER A 72 A 3 4 N ASP A 76 ? N ASP A 77 O ARG A 84 ? O ARG A 85 A 4 5 N SER A 87 ? N SER A 88 O ARG A 142 ? O ARG A 143 A 5 6 O VAL A 132 ? O VAL A 133 N THR A 54 ? N THR A 55 A 6 7 O TRP A 51 ? O TRP A 52 N ALA A 44 ? N ALA A 45 # _database_PDB_matrix.entry_id 1RFE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RFE _atom_sites.fract_transf_matrix[1][1] 0.020280 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020280 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007542 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 2 ? ? ? A . n A 1 2 THR 2 3 3 THR THR A . n A 1 3 LYS 3 4 4 LYS LYS A . n A 1 4 GLN 4 5 5 GLN GLN A . n A 1 5 ARG 5 6 6 ARG ARG A . n A 1 6 ALA 6 7 7 ALA ALA A . n A 1 7 ASP 7 8 8 ASP ASP A . n A 1 8 ILE 8 9 9 ILE ILE A . n A 1 9 VAL 9 10 10 VAL VAL A . n A 1 10 MSE 10 11 11 MSE MSE A . n A 1 11 SER 11 12 12 SER SER A . n A 1 12 GLU 12 13 13 GLU GLU A . n A 1 13 ALA 13 14 14 ALA ALA A . n A 1 14 GLU 14 15 15 GLU GLU A . n A 1 15 ILE 15 16 16 ILE ILE A . n A 1 16 ALA 16 17 17 ALA ALA A . n A 1 17 ASP 17 18 18 ASP ASP A . n A 1 18 PHE 18 19 19 PHE PHE A . n A 1 19 VAL 19 20 20 VAL VAL A . n A 1 20 ASN 20 21 21 ASN ASN A . n A 1 21 SER 21 22 22 SER SER A . n A 1 22 SER 22 23 23 SER SER A . n A 1 23 ARG 23 24 24 ARG ARG A . n A 1 24 THR 24 25 25 THR THR A . n A 1 25 GLY 25 26 26 GLY GLY A . n A 1 26 THR 26 27 27 THR THR A . n A 1 27 LEU 27 28 28 LEU LEU A . n A 1 28 ALA 28 29 29 ALA ALA A . n A 1 29 THR 29 30 30 THR THR A . n A 1 30 ILE 30 31 31 ILE ILE A . n A 1 31 GLY 31 32 32 GLY GLY A . n A 1 32 PRO 32 33 33 PRO PRO A . n A 1 33 ASP 33 34 34 ASP ASP A . n A 1 34 GLY 34 35 35 GLY GLY A . n A 1 35 GLN 35 36 36 GLN GLN A . n A 1 36 PRO 36 37 37 PRO PRO A . n A 1 37 HIS 37 38 38 HIS HIS A . n A 1 38 LEU 38 39 39 LEU LEU A . n A 1 39 THR 39 40 40 THR THR A . n A 1 40 ALA 40 41 41 ALA ALA A . n A 1 41 MSE 41 42 42 MSE MSE A . n A 1 42 TRP 42 43 43 TRP TRP A . n A 1 43 TYR 43 44 44 TYR TYR A . n A 1 44 ALA 44 45 45 ALA ALA A . n A 1 45 VAL 45 46 46 VAL VAL A . n A 1 46 ILE 46 47 47 ILE ILE A . n A 1 47 ASP 47 48 48 ASP ASP A . n A 1 48 GLY 48 49 49 GLY GLY A . n A 1 49 GLU 49 50 50 GLU GLU A . n A 1 50 ILE 50 51 51 ILE ILE A . n A 1 51 TRP 51 52 52 TRP TRP A . n A 1 52 LEU 52 53 53 LEU LEU A . n A 1 53 GLU 53 54 54 GLU GLU A . n A 1 54 THR 54 55 55 THR THR A . n A 1 55 LYS 55 56 56 LYS LYS A . n A 1 56 ALA 56 57 57 ALA ALA A . n A 1 57 LYS 57 58 58 LYS LYS A . n A 1 58 SER 58 59 59 SER SER A . n A 1 59 GLN 59 60 60 GLN GLN A . n A 1 60 LYS 60 61 61 LYS LYS A . n A 1 61 ALA 61 62 62 ALA ALA A . n A 1 62 VAL 62 63 63 VAL VAL A . n A 1 63 ASN 63 64 64 ASN ASN A . n A 1 64 LEU 64 65 65 LEU LEU A . n A 1 65 ARG 65 66 66 ARG ARG A . n A 1 66 ARG 66 67 67 ARG ARG A . n A 1 67 ASP 67 68 68 ASP ASP A . n A 1 68 PRO 68 69 69 PRO PRO A . n A 1 69 ARG 69 70 70 ARG ARG A . n A 1 70 VAL 70 71 71 VAL VAL A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 PHE 72 73 73 PHE PHE A . n A 1 73 LEU 73 74 74 LEU LEU A . n A 1 74 LEU 74 75 75 LEU LEU A . n A 1 75 GLU 75 76 76 GLU GLU A . n A 1 76 ASP 76 77 77 ASP ASP A . n A 1 77 GLY 77 78 78 GLY GLY A . n A 1 78 ASP 78 79 79 ASP ASP A . n A 1 79 THR 79 80 80 THR THR A . n A 1 80 TYR 80 81 81 TYR TYR A . n A 1 81 ASP 81 82 82 ASP ASP A . n A 1 82 THR 82 83 83 THR THR A . n A 1 83 LEU 83 84 84 LEU LEU A . n A 1 84 ARG 84 85 85 ARG ARG A . n A 1 85 GLY 85 86 86 GLY GLY A . n A 1 86 VAL 86 87 87 VAL VAL A . n A 1 87 SER 87 88 88 SER SER A . n A 1 88 PHE 88 89 89 PHE PHE A . n A 1 89 GLU 89 90 90 GLU GLU A . n A 1 90 GLY 90 91 91 GLY GLY A . n A 1 91 VAL 91 92 92 VAL VAL A . n A 1 92 ALA 92 93 93 ALA ALA A . n A 1 93 GLU 93 94 94 GLU GLU A . n A 1 94 ILE 94 95 95 ILE ILE A . n A 1 95 VAL 95 96 96 VAL VAL A . n A 1 96 GLU 96 97 97 GLU GLU A . n A 1 97 GLU 97 98 98 GLU GLU A . n A 1 98 PRO 98 99 99 PRO PRO A . n A 1 99 GLU 99 100 100 GLU GLU A . n A 1 100 ALA 100 101 101 ALA ALA A . n A 1 101 LEU 101 102 102 LEU LEU A . n A 1 102 HIS 102 103 103 HIS HIS A . n A 1 103 ARG 103 104 104 ARG ARG A . n A 1 104 VAL 104 105 105 VAL VAL A . n A 1 105 GLY 105 106 106 GLY GLY A . n A 1 106 VAL 106 107 107 VAL VAL A . n A 1 107 SER 107 108 108 SER SER A . n A 1 108 VAL 108 109 109 VAL VAL A . n A 1 109 TRP 109 110 110 TRP TRP A . n A 1 110 GLU 110 111 111 GLU GLU A . n A 1 111 ARG 111 112 112 ARG ARG A . n A 1 112 TYR 112 113 113 TYR TYR A . n A 1 113 THR 113 114 114 THR THR A . n A 1 114 GLY 114 115 115 GLY GLY A . n A 1 115 PRO 115 116 116 PRO PRO A . n A 1 116 TYR 116 117 117 TYR TYR A . n A 1 117 THR 117 118 118 THR THR A . n A 1 118 ASP 118 119 119 ASP ASP A . n A 1 119 GLU 119 120 120 GLU GLU A . n A 1 120 CSX 120 121 121 CSX CSX A . n A 1 121 LYS 121 122 122 LYS LYS A . n A 1 122 PRO 122 123 123 PRO PRO A . n A 1 123 MSE 123 124 124 MSE MSE A . n A 1 124 VAL 124 125 125 VAL VAL A . n A 1 125 ASP 125 126 126 ASP ASP A . n A 1 126 GLN 126 127 127 GLN GLN A . n A 1 127 MSE 127 128 128 MSE MSE A . n A 1 128 MSE 128 129 129 MSE MSE A . n A 1 129 ASN 129 130 130 ASN ASN A . n A 1 130 LYS 130 131 131 LYS LYS A . n A 1 131 ARG 131 132 132 ARG ARG A . n A 1 132 VAL 132 133 133 VAL VAL A . n A 1 133 GLY 133 134 134 GLY GLY A . n A 1 134 VAL 134 135 135 VAL VAL A . n A 1 135 ARG 135 136 136 ARG ARG A . n A 1 136 ILE 136 137 137 ILE ILE A . n A 1 137 VAL 137 138 138 VAL VAL A . n A 1 138 ALA 138 139 139 ALA ALA A . n A 1 139 ARG 139 140 140 ARG ARG A . n A 1 140 ARG 140 141 141 ARG ARG A . n A 1 141 THR 141 142 142 THR THR A . n A 1 142 ARG 142 143 143 ARG ARG A . n A 1 143 SER 143 144 144 SER SER A . n A 1 144 TRP 144 145 145 TRP TRP A . n A 1 145 ASP 145 146 146 ASP ASP A . n A 1 146 HIS 146 147 147 HIS HIS A . n A 1 147 ARG 147 148 148 ARG ARG A . n A 1 148 LYS 148 149 149 LYS LYS A . n A 1 149 LEU 149 150 150 LEU LEU A . n A 1 150 GLY 150 151 151 GLY GLY A . n A 1 151 LEU 151 152 152 LEU LEU A . n A 1 152 PRO 152 153 153 PRO PRO A . n A 1 153 HIS 153 154 154 HIS HIS A . n A 1 154 MSE 154 155 155 MSE MSE A . n A 1 155 SER 155 156 156 SER SER A . n A 1 156 VAL 156 157 157 VAL VAL A . n A 1 157 GLY 157 158 158 GLY GLY A . n A 1 158 GLY 158 159 159 GLY GLY A . n A 1 159 SER 159 160 160 SER SER A . n A 1 160 THR 160 161 161 THR THR A . n A 1 161 ALA 161 162 162 ALA ALA A . n A 1 162 PRO 162 163 ? ? ? A . n # _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'TB Structural Genomics Consortium' _pdbx_SG_project.initial_of_center TBSGC _pdbx_SG_project.id 1 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 164 1 HOH HOH A . B 2 HOH 2 165 2 HOH HOH A . B 2 HOH 3 166 3 HOH HOH A . B 2 HOH 4 167 4 HOH HOH A . B 2 HOH 5 168 5 HOH HOH A . B 2 HOH 6 169 6 HOH HOH A . B 2 HOH 7 170 7 HOH HOH A . B 2 HOH 8 171 8 HOH HOH A . B 2 HOH 9 172 9 HOH HOH A . B 2 HOH 10 173 10 HOH HOH A . B 2 HOH 11 174 11 HOH HOH A . B 2 HOH 12 175 12 HOH HOH A . B 2 HOH 13 176 13 HOH HOH A . B 2 HOH 14 177 14 HOH HOH A . B 2 HOH 15 178 15 HOH HOH A . B 2 HOH 16 179 16 HOH HOH A . B 2 HOH 17 180 17 HOH HOH A . B 2 HOH 18 181 18 HOH HOH A . B 2 HOH 19 182 19 HOH HOH A . B 2 HOH 20 183 20 HOH HOH A . B 2 HOH 21 184 21 HOH HOH A . B 2 HOH 22 185 22 HOH HOH A . B 2 HOH 23 186 23 HOH HOH A . B 2 HOH 24 187 24 HOH HOH A . B 2 HOH 25 188 25 HOH HOH A . B 2 HOH 26 189 26 HOH HOH A . B 2 HOH 27 190 27 HOH HOH A . B 2 HOH 28 191 28 HOH HOH A . B 2 HOH 29 192 29 HOH HOH A . B 2 HOH 30 193 30 HOH HOH A . B 2 HOH 31 194 31 HOH HOH A . B 2 HOH 32 195 32 HOH HOH A . B 2 HOH 33 196 33 HOH HOH A . B 2 HOH 34 197 34 HOH HOH A . B 2 HOH 35 198 35 HOH HOH A . B 2 HOH 36 199 36 HOH HOH A . B 2 HOH 37 200 37 HOH HOH A . B 2 HOH 38 201 38 HOH HOH A . B 2 HOH 39 202 39 HOH HOH A . B 2 HOH 40 203 40 HOH HOH A . B 2 HOH 41 204 41 HOH HOH A . B 2 HOH 42 205 42 HOH HOH A . B 2 HOH 43 206 43 HOH HOH A . B 2 HOH 44 207 44 HOH HOH A . B 2 HOH 45 208 45 HOH HOH A . B 2 HOH 46 209 46 HOH HOH A . B 2 HOH 47 210 47 HOH HOH A . B 2 HOH 48 211 48 HOH HOH A . B 2 HOH 49 212 49 HOH HOH A . B 2 HOH 50 213 50 HOH HOH A . B 2 HOH 51 214 51 HOH HOH A . B 2 HOH 52 215 52 HOH HOH A . B 2 HOH 53 216 53 HOH HOH A . B 2 HOH 54 217 54 HOH HOH A . B 2 HOH 55 218 55 HOH HOH A . B 2 HOH 56 219 56 HOH HOH A . B 2 HOH 57 220 57 HOH HOH A . B 2 HOH 58 221 58 HOH HOH A . B 2 HOH 59 222 59 HOH HOH A . B 2 HOH 60 223 60 HOH HOH A . B 2 HOH 61 224 61 HOH HOH A . B 2 HOH 62 225 62 HOH HOH A . B 2 HOH 63 226 63 HOH HOH A . B 2 HOH 64 227 64 HOH HOH A . B 2 HOH 65 228 65 HOH HOH A . B 2 HOH 66 229 66 HOH HOH A . B 2 HOH 67 230 67 HOH HOH A . B 2 HOH 68 231 68 HOH HOH A . B 2 HOH 69 232 69 HOH HOH A . B 2 HOH 70 233 70 HOH HOH A . B 2 HOH 71 234 71 HOH HOH A . B 2 HOH 72 235 72 HOH HOH A . B 2 HOH 73 236 73 HOH HOH A . B 2 HOH 74 237 74 HOH HOH A . B 2 HOH 75 238 75 HOH HOH A . B 2 HOH 76 239 76 HOH HOH A . B 2 HOH 77 240 77 HOH HOH A . B 2 HOH 78 241 78 HOH HOH A . B 2 HOH 79 242 79 HOH HOH A . B 2 HOH 80 243 80 HOH HOH A . B 2 HOH 81 244 81 HOH HOH A . B 2 HOH 82 245 82 HOH HOH A . B 2 HOH 83 246 83 HOH HOH A . B 2 HOH 84 247 84 HOH HOH A . B 2 HOH 85 248 85 HOH HOH A . B 2 HOH 86 249 86 HOH HOH A . B 2 HOH 87 250 87 HOH HOH A . B 2 HOH 88 251 88 HOH HOH A . B 2 HOH 89 252 89 HOH HOH A . B 2 HOH 90 253 90 HOH HOH A . B 2 HOH 91 254 91 HOH HOH A . B 2 HOH 92 255 92 HOH HOH A . B 2 HOH 93 256 93 HOH HOH A . B 2 HOH 94 257 94 HOH HOH A . B 2 HOH 95 258 95 HOH HOH A . B 2 HOH 96 259 96 HOH HOH A . B 2 HOH 97 260 97 HOH HOH A . B 2 HOH 98 261 98 HOH HOH A . B 2 HOH 99 262 99 HOH HOH A . B 2 HOH 100 263 100 HOH HOH A . B 2 HOH 101 264 101 HOH HOH A . B 2 HOH 102 265 102 HOH HOH A . B 2 HOH 103 266 103 HOH HOH A . B 2 HOH 104 267 104 HOH HOH A . B 2 HOH 105 268 105 HOH HOH A . B 2 HOH 106 269 106 HOH HOH A . B 2 HOH 107 270 107 HOH HOH A . B 2 HOH 108 271 108 HOH HOH A . B 2 HOH 109 272 109 HOH HOH A . B 2 HOH 110 273 110 HOH HOH A . B 2 HOH 111 274 111 HOH HOH A . B 2 HOH 112 275 112 HOH HOH A . B 2 HOH 113 276 113 HOH HOH A . B 2 HOH 114 277 114 HOH HOH A . B 2 HOH 115 278 115 HOH HOH A . B 2 HOH 116 279 116 HOH HOH A . B 2 HOH 117 280 117 HOH HOH A . B 2 HOH 118 281 118 HOH HOH A . B 2 HOH 119 282 119 HOH HOH A . B 2 HOH 120 283 120 HOH HOH A . B 2 HOH 121 284 121 HOH HOH A . B 2 HOH 122 285 122 HOH HOH A . B 2 HOH 123 286 123 HOH HOH A . B 2 HOH 124 287 124 HOH HOH A . B 2 HOH 125 288 125 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 10 A MSE 11 ? MET SELENOMETHIONINE 2 A MSE 41 A MSE 42 ? MET SELENOMETHIONINE 3 A CSX 120 A CSX 121 ? CYS 'S-OXY CYSTEINE' 4 A MSE 123 A MSE 124 ? MET SELENOMETHIONINE 5 A MSE 127 A MSE 128 ? MET SELENOMETHIONINE 6 A MSE 128 A MSE 129 ? MET SELENOMETHIONINE 7 A MSE 154 A MSE 155 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 243 ? B HOH . 2 1 A HOH 244 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-12-28 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-04-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' citation_author 3 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.country' 2 4 'Structure model' '_citation.journal_abbrev' 3 4 'Structure model' '_citation.journal_id_ASTM' 4 4 'Structure model' '_citation.journal_id_CSD' 5 4 'Structure model' '_citation.journal_id_ISSN' 6 4 'Structure model' '_citation.pdbx_database_id_DOI' 7 4 'Structure model' '_citation.pdbx_database_id_PubMed' 8 4 'Structure model' '_citation.title' 9 4 'Structure model' '_citation.year' 10 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SHELXD phasing . ? 4 SHARP phasing . ? 5 ARP/wARP 'model building' . ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 168 ? ? O A HOH 256 ? ? 1.99 2 1 O A HOH 174 ? ? O A HOH 276 ? ? 2.18 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 123.58 120.30 3.28 0.50 N 2 1 NE A ARG 136 ? ? CZ A ARG 136 ? ? NH1 A ARG 136 ? ? 124.59 120.30 4.29 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 4 ? ? 140.69 -134.73 2 1 GLN A 5 ? ? 111.03 99.25 3 1 THR A 114 ? ? -120.61 -50.24 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 3 ? CB ? A THR 2 CB 2 1 Y 1 A THR 3 ? OG1 ? A THR 2 OG1 3 1 Y 1 A THR 3 ? CG2 ? A THR 2 CG2 4 1 Y 1 A LYS 4 ? CB ? A LYS 3 CB 5 1 Y 1 A LYS 4 ? CG ? A LYS 3 CG 6 1 Y 1 A LYS 4 ? CD ? A LYS 3 CD 7 1 Y 1 A LYS 4 ? CE ? A LYS 3 CE 8 1 Y 1 A LYS 4 ? NZ ? A LYS 3 NZ 9 1 Y 1 A GLU 54 ? OE2 ? A GLU 53 OE2 10 1 Y 1 A LYS 56 ? CE ? A LYS 55 CE 11 1 Y 1 A LYS 56 ? NZ ? A LYS 55 NZ 12 1 Y 1 A ARG 67 ? NE ? A ARG 66 NE 13 1 Y 1 A ARG 67 ? CZ ? A ARG 66 CZ 14 1 Y 1 A ARG 67 ? NH1 ? A ARG 66 NH1 15 1 Y 1 A ARG 67 ? NH2 ? A ARG 66 NH2 16 1 Y 1 A GLU 100 ? CD ? A GLU 99 CD 17 1 Y 1 A GLU 100 ? OE1 ? A GLU 99 OE1 18 1 Y 1 A GLU 100 ? OE2 ? A GLU 99 OE2 19 1 Y 1 A GLU 120 ? CD ? A GLU 119 CD 20 1 Y 1 A GLU 120 ? OE1 ? A GLU 119 OE1 21 1 Y 1 A GLU 120 ? OE2 ? A GLU 119 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 2 ? A GLY 1 2 1 Y 1 A PRO 163 ? A PRO 162 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #