data_1RGV # _entry.id 1RGV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1RGV RCSB RCSB020734 WWPDB D_1000020734 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RGV _pdbx_database_status.recvd_initial_deposition_date 2003-11-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Unciuleac, M.' 1 'Boll, M.' 2 'Warkentin, E.' 3 'Ermler, U.' 4 # _citation.id primary _citation.title 'Crystallization of 4-hydroxybenzoyl-CoA reductase and the structure of its electron donor ferredoxin.' _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 60 _citation.page_first 388 _citation.page_last 391 _citation.year 2004 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14747735 _citation.pdbx_database_id_DOI 10.1107/S0907444903028506 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Unciuleac, M.' 1 primary 'Boll, M.' 2 primary 'Warkentin, E.' 3 primary 'Ermler, U.' 4 # _cell.entry_id 1RGV _cell.length_a 79.000 _cell.length_b 79.000 _cell.length_c 49.300 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RGV _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat ferredoxin 8963.895 1 ? ? ? ? 2 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ALYINDDCTACDACVEECPNEAITPGDPIYVIDPTKCSECVGAFDEPQCRLVCPADCIPDNPDYRETREELQEKYDRLHG _entity_poly.pdbx_seq_one_letter_code_can ALYINDDCTACDACVEECPNEAITPGDPIYVIDPTKCSECVGAFDEPQCRLVCPADCIPDNPDYRETREELQEKYDRLHG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LEU n 1 3 TYR n 1 4 ILE n 1 5 ASN n 1 6 ASP n 1 7 ASP n 1 8 CYS n 1 9 THR n 1 10 ALA n 1 11 CYS n 1 12 ASP n 1 13 ALA n 1 14 CYS n 1 15 VAL n 1 16 GLU n 1 17 GLU n 1 18 CYS n 1 19 PRO n 1 20 ASN n 1 21 GLU n 1 22 ALA n 1 23 ILE n 1 24 THR n 1 25 PRO n 1 26 GLY n 1 27 ASP n 1 28 PRO n 1 29 ILE n 1 30 TYR n 1 31 VAL n 1 32 ILE n 1 33 ASP n 1 34 PRO n 1 35 THR n 1 36 LYS n 1 37 CYS n 1 38 SER n 1 39 GLU n 1 40 CYS n 1 41 VAL n 1 42 GLY n 1 43 ALA n 1 44 PHE n 1 45 ASP n 1 46 GLU n 1 47 PRO n 1 48 GLN n 1 49 CYS n 1 50 ARG n 1 51 LEU n 1 52 VAL n 1 53 CYS n 1 54 PRO n 1 55 ALA n 1 56 ASP n 1 57 CYS n 1 58 ILE n 1 59 PRO n 1 60 ASP n 1 61 ASN n 1 62 PRO n 1 63 ASP n 1 64 TYR n 1 65 ARG n 1 66 GLU n 1 67 THR n 1 68 ARG n 1 69 GLU n 1 70 GLU n 1 71 LEU n 1 72 GLN n 1 73 GLU n 1 74 LYS n 1 75 TYR n 1 76 ASP n 1 77 ARG n 1 78 LEU n 1 79 HIS n 1 80 GLY n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Thauera aromatica' _entity_src_nat.pdbx_ncbi_taxonomy_id 44139 _entity_src_nat.genus Thauera _entity_src_nat.species 'Thauera aromatica' _entity_src_nat.strain K172 _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O88151_THAAR _struct_ref.pdbx_db_accession O88151 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ALYINDDCTACDACVEECPNEAITPGDPIYVIDPTKCSECVGAFDEPQCRLVCPADCIPDNPDYRETREELQEKYDRLHG ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RGV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O88151 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 81 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 80 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SF4 non-polymer . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4' 351.640 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1RGV _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 76.8 _exptl_crystal.description ? _exptl_crystal.density_Matthews 5.3 # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 281 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.8 _exptl_crystal_grow.pdbx_details 'sodium citrate, ammonium phosphate, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 281K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2001-02-18 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Multilayer _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.54 # _reflns.entry_id 1RGV _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.9 _reflns.number_obs 3953 _reflns.number_all 3953 _reflns.percent_possible_obs 95.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.094 _reflns.pdbx_netI_over_sigmaI 12.4 _reflns.B_iso_Wilson_estimate 1.3 _reflns.pdbx_redundancy 3.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.9 _reflns_shell.d_res_low 3.0 _reflns_shell.percent_possible_all 70. _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.38 _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.pdbx_redundancy 1.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 282 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1RGV _refine.ls_number_reflns_obs 3753 _refine.ls_number_reflns_all 3753 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1092461.40 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 25.86 _refine.ls_d_res_high 2.90 _refine.ls_percent_reflns_obs 91.1 _refine.ls_R_factor_obs 0.197 _refine.ls_R_factor_all 0.197 _refine.ls_R_factor_R_work 0.197 _refine.ls_R_factor_R_free 0.219 _refine.ls_R_factor_R_free_error 0.016 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.3 _refine.ls_number_reflns_R_free 198 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 48.7 _refine.aniso_B[1][1] 3.31 _refine.aniso_B[2][2] 3.31 _refine.aniso_B[3][3] -6.63 _refine.aniso_B[1][2] 9.98 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.366861 _refine.solvent_model_param_bsol 28.1492 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ;Ferredoxin from Allochromatium vinosum (PDB 1BLU) ; _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1RGV _refine_analyze.Luzzati_coordinate_error_obs 0.34 _refine_analyze.Luzzati_sigma_a_obs 0.49 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.34 _refine_analyze.Luzzati_sigma_a_free 0.19 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 621 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 637 _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 25.86 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.3 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.83 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 0.90 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 1.61 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 1.45 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 2.16 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.90 _refine_ls_shell.d_res_low 3.08 _refine_ls_shell.number_reflns_R_work 433 _refine_ls_shell.R_factor_R_work 0.329 _refine_ls_shell.percent_reflns_obs 68.2 _refine_ls_shell.R_factor_R_free 0.226 _refine_ls_shell.R_factor_R_free_error 0.044 _refine_ls_shell.percent_reflns_R_free 5.7 _refine_ls_shell.number_reflns_R_free 26 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 PARAM.FES TOPH.FES 'X-RAY DIFFRACTION' 3 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 4 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1RGV _struct.title 'Crystal Structure of the Ferredoxin from Thauera aromatica' _struct.pdbx_descriptor ferredoxin _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RGV _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'electron transport' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 47 ? CYS A 53 ? PRO A 47 CYS A 53 1 ? 7 HELX_P HELX_P2 2 ASN A 61 ? ARG A 65 ? ASN A 61 ARG A 65 5 ? 5 HELX_P HELX_P3 3 THR A 67 ? HIS A 79 ? THR A 67 HIS A 79 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A CYS 8 SG ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 8 A SF4 101 1_555 ? ? ? ? ? ? ? 2.484 ? metalc2 metalc ? ? A CYS 11 SG ? ? ? 1_555 B SF4 . FE4 ? ? A CYS 11 A SF4 101 1_555 ? ? ? ? ? ? ? 2.467 ? metalc3 metalc ? ? A CYS 14 SG ? ? ? 1_555 B SF4 . FE2 ? ? A CYS 14 A SF4 101 1_555 ? ? ? ? ? ? ? 2.508 ? metalc4 metalc ? ? A CYS 18 SG ? ? ? 1_555 C SF4 . FE1 ? ? A CYS 18 A SF4 102 1_555 ? ? ? ? ? ? ? 2.434 ? metalc5 metalc ? ? A CYS 37 SG ? ? ? 1_555 C SF4 . FE3 ? ? A CYS 37 A SF4 102 1_555 ? ? ? ? ? ? ? 2.502 ? metalc6 metalc ? ? A CYS 40 SG ? ? ? 1_555 C SF4 . FE4 ? ? A CYS 40 A SF4 102 1_555 ? ? ? ? ? ? ? 2.509 ? metalc7 metalc ? ? A CYS 53 SG ? ? ? 1_555 B SF4 . FE1 ? ? A CYS 53 A SF4 101 1_555 ? ? ? ? ? ? ? 2.501 ? metalc8 metalc ? ? A CYS 49 SG ? ? ? 1_555 C SF4 . FE2 ? ? A CYS 49 A SF4 102 1_555 ? ? ? ? ? ? ? 2.564 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 27 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 27 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 28 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 28 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.31 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 23 ? THR A 24 ? ILE A 23 THR A 24 A 2 VAL A 31 ? ILE A 32 ? VAL A 31 ILE A 32 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 31 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 31 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SF4 A 101' AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SF4 A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 CYS A 8 ? CYS A 8 . ? 1_555 ? 2 AC1 7 THR A 9 ? THR A 9 . ? 1_555 ? 3 AC1 7 CYS A 11 ? CYS A 11 . ? 1_555 ? 4 AC1 7 ASP A 12 ? ASP A 12 . ? 1_555 ? 5 AC1 7 CYS A 14 ? CYS A 14 . ? 1_555 ? 6 AC1 7 CYS A 53 ? CYS A 53 . ? 1_555 ? 7 AC1 7 CYS A 57 ? CYS A 57 . ? 1_555 ? 8 AC2 7 CYS A 18 ? CYS A 18 . ? 1_555 ? 9 AC2 7 PRO A 19 ? PRO A 19 . ? 1_555 ? 10 AC2 7 CYS A 37 ? CYS A 37 . ? 1_555 ? 11 AC2 7 GLU A 39 ? GLU A 39 . ? 1_555 ? 12 AC2 7 CYS A 40 ? CYS A 40 . ? 1_555 ? 13 AC2 7 PRO A 47 ? PRO A 47 . ? 1_555 ? 14 AC2 7 CYS A 49 ? CYS A 49 . ? 1_555 ? # _database_PDB_matrix.entry_id 1RGV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RGV _atom_sites.fract_transf_matrix[1][1] 0.012658 _atom_sites.fract_transf_matrix[1][2] 0.007308 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014616 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020284 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 GLY 80 80 80 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SF4 1 101 101 SF4 FS4 A . C 2 SF4 1 102 102 SF4 FS4 A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 8 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S1 ? B SF4 . ? A SF4 101 ? 1_555 93.9 ? 2 SG ? A CYS 8 ? A CYS 8 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S2 ? B SF4 . ? A SF4 101 ? 1_555 118.8 ? 3 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S2 ? B SF4 . ? A SF4 101 ? 1_555 100.0 ? 4 SG ? A CYS 8 ? A CYS 8 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 125.5 ? 5 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 104.1 ? 6 S2 ? B SF4 . ? A SF4 101 ? 1_555 FE3 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 108.1 ? 7 SG ? A CYS 11 ? A CYS 11 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S1 ? B SF4 . ? A SF4 101 ? 1_555 129.3 ? 8 SG ? A CYS 11 ? A CYS 11 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S2 ? B SF4 . ? A SF4 101 ? 1_555 120.1 ? 9 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S2 ? B SF4 . ? A SF4 101 ? 1_555 98.5 ? 10 SG ? A CYS 11 ? A CYS 11 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 96.4 ? 11 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 101.0 ? 12 S2 ? B SF4 . ? A SF4 101 ? 1_555 FE4 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 108.7 ? 13 SG ? A CYS 14 ? A CYS 14 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S1 ? B SF4 . ? A SF4 101 ? 1_555 113.2 ? 14 SG ? A CYS 14 ? A CYS 14 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 107.3 ? 15 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 107.1 ? 16 SG ? A CYS 14 ? A CYS 14 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 122.1 ? 17 S1 ? B SF4 . ? A SF4 101 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 100.2 ? 18 S3 ? B SF4 . ? A SF4 101 ? 1_555 FE2 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 105.9 ? 19 SG ? A CYS 18 ? A CYS 18 ? 1_555 FE1 ? C SF4 . ? A SF4 102 ? 1_555 S2 ? C SF4 . ? A SF4 102 ? 1_555 127.2 ? 20 SG ? A CYS 18 ? A CYS 18 ? 1_555 FE1 ? C SF4 . ? A SF4 102 ? 1_555 S3 ? C SF4 . ? A SF4 102 ? 1_555 110.4 ? 21 S2 ? C SF4 . ? A SF4 102 ? 1_555 FE1 ? C SF4 . ? A SF4 102 ? 1_555 S3 ? C SF4 . ? A SF4 102 ? 1_555 99.1 ? 22 SG ? A CYS 18 ? A CYS 18 ? 1_555 FE1 ? C SF4 . ? A SF4 102 ? 1_555 S4 ? C SF4 . ? A SF4 102 ? 1_555 117.5 ? 23 S2 ? C SF4 . ? A SF4 102 ? 1_555 FE1 ? C SF4 . ? A SF4 102 ? 1_555 S4 ? C SF4 . ? A SF4 102 ? 1_555 99.3 ? 24 S3 ? C SF4 . ? A SF4 102 ? 1_555 FE1 ? C SF4 . ? A SF4 102 ? 1_555 S4 ? C SF4 . ? A SF4 102 ? 1_555 98.5 ? 25 SG ? A CYS 37 ? A CYS 37 ? 1_555 FE3 ? C SF4 . ? A SF4 102 ? 1_555 S1 ? C SF4 . ? A SF4 102 ? 1_555 107.1 ? 26 SG ? A CYS 37 ? A CYS 37 ? 1_555 FE3 ? C SF4 . ? A SF4 102 ? 1_555 S2 ? C SF4 . ? A SF4 102 ? 1_555 122.2 ? 27 S1 ? C SF4 . ? A SF4 102 ? 1_555 FE3 ? C SF4 . ? A SF4 102 ? 1_555 S2 ? C SF4 . ? A SF4 102 ? 1_555 99.9 ? 28 SG ? A CYS 37 ? A CYS 37 ? 1_555 FE3 ? C SF4 . ? A SF4 102 ? 1_555 S4 ? C SF4 . ? A SF4 102 ? 1_555 113.1 ? 29 S1 ? C SF4 . ? A SF4 102 ? 1_555 FE3 ? C SF4 . ? A SF4 102 ? 1_555 S4 ? C SF4 . ? A SF4 102 ? 1_555 104.0 ? 30 S2 ? C SF4 . ? A SF4 102 ? 1_555 FE3 ? C SF4 . ? A SF4 102 ? 1_555 S4 ? C SF4 . ? A SF4 102 ? 1_555 108.2 ? 31 SG ? A CYS 40 ? A CYS 40 ? 1_555 FE4 ? C SF4 . ? A SF4 102 ? 1_555 S1 ? C SF4 . ? A SF4 102 ? 1_555 115.6 ? 32 SG ? A CYS 40 ? A CYS 40 ? 1_555 FE4 ? C SF4 . ? A SF4 102 ? 1_555 S2 ? C SF4 . ? A SF4 102 ? 1_555 132.4 ? 33 S1 ? C SF4 . ? A SF4 102 ? 1_555 FE4 ? C SF4 . ? A SF4 102 ? 1_555 S2 ? C SF4 . ? A SF4 102 ? 1_555 98.3 ? 34 SG ? A CYS 40 ? A CYS 40 ? 1_555 FE4 ? C SF4 . ? A SF4 102 ? 1_555 S3 ? C SF4 . ? A SF4 102 ? 1_555 97.1 ? 35 S1 ? C SF4 . ? A SF4 102 ? 1_555 FE4 ? C SF4 . ? A SF4 102 ? 1_555 S3 ? C SF4 . ? A SF4 102 ? 1_555 101.2 ? 36 S2 ? C SF4 . ? A SF4 102 ? 1_555 FE4 ? C SF4 . ? A SF4 102 ? 1_555 S3 ? C SF4 . ? A SF4 102 ? 1_555 108.6 ? 37 SG ? A CYS 53 ? A CYS 53 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S2 ? B SF4 . ? A SF4 101 ? 1_555 122.0 ? 38 SG ? A CYS 53 ? A CYS 53 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 118.3 ? 39 S2 ? B SF4 . ? A SF4 101 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S3 ? B SF4 . ? A SF4 101 ? 1_555 99.3 ? 40 SG ? A CYS 53 ? A CYS 53 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 115.3 ? 41 S2 ? B SF4 . ? A SF4 101 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 99.5 ? 42 S3 ? B SF4 . ? A SF4 101 ? 1_555 FE1 ? B SF4 . ? A SF4 101 ? 1_555 S4 ? B SF4 . ? A SF4 101 ? 1_555 98.2 ? 43 SG ? A CYS 49 ? A CYS 49 ? 1_555 FE2 ? C SF4 . ? A SF4 102 ? 1_555 S1 ? C SF4 . ? A SF4 102 ? 1_555 104.3 ? 44 SG ? A CYS 49 ? A CYS 49 ? 1_555 FE2 ? C SF4 . ? A SF4 102 ? 1_555 S3 ? C SF4 . ? A SF4 102 ? 1_555 115.2 ? 45 S1 ? C SF4 . ? A SF4 102 ? 1_555 FE2 ? C SF4 . ? A SF4 102 ? 1_555 S3 ? C SF4 . ? A SF4 102 ? 1_555 107.0 ? 46 SG ? A CYS 49 ? A CYS 49 ? 1_555 FE2 ? C SF4 . ? A SF4 102 ? 1_555 S4 ? C SF4 . ? A SF4 102 ? 1_555 122.0 ? 47 S1 ? C SF4 . ? A SF4 102 ? 1_555 FE2 ? C SF4 . ? A SF4 102 ? 1_555 S4 ? C SF4 . ? A SF4 102 ? 1_555 100.3 ? 48 S3 ? C SF4 . ? A SF4 102 ? 1_555 FE2 ? C SF4 . ? A SF4 102 ? 1_555 S4 ? C SF4 . ? A SF4 102 ? 1_555 106.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-02-10 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.0 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 EPMR phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 5 ? ? -60.90 -176.30 2 1 ASP A 12 ? ? 67.01 -3.71 3 1 CYS A 40 ? ? 71.92 -2.15 4 1 ALA A 43 ? ? -136.69 -50.56 5 1 HIS A 79 ? ? -116.00 -88.28 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'IRON/SULFUR CLUSTER' _pdbx_entity_nonpoly.comp_id SF4 #