data_1RJI # _entry.id 1RJI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RJI pdb_00001rji 10.2210/pdb1rji/pdb RCSB RCSB020804 ? ? WWPDB D_1000020804 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-12-09 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RJI _pdbx_database_status.recvd_initial_deposition_date 2003-11-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cai, Z.' 1 'Wu, J.' 2 'Xu, Y.' 3 'Wang, C.-G.' 4 'Chi, C.-W.' 5 'Shi, Y.' 6 # _citation.id primary _citation.title ;A novel short-chain peptide BmKX from the Chinese scorpion Buthus martensi karsch, sequencing, gene cloning and structure determination ; _citation.journal_abbrev Toxicon _citation.journal_volume 45 _citation.page_first 309 _citation.page_last 319 _citation.year 2005 _citation.journal_id_ASTM TOXIA6 _citation.country UK _citation.journal_id_ISSN 0041-0101 _citation.journal_id_CSD 2043 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15683869 _citation.pdbx_database_id_DOI 10.1016/j.toxicon.2004.11.014 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, C.-G.' 1 ? primary 'Cai, Z.' 2 ? primary 'Lu, W.' 3 ? primary 'Wu, J.' 4 ? primary 'Xu, Y.' 5 ? primary 'Shi, Y.' 6 ? primary 'Chi, C.-W.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'potassium channel toxin KX' _entity.formula_weight 3333.882 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name BmKX # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TPYPVNCKTDRDCVMCGLGISCKNGYCQGCT _entity_poly.pdbx_seq_one_letter_code_can TPYPVNCKTDRDCVMCGLGISCKNGYCQGCT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 PRO n 1 3 TYR n 1 4 PRO n 1 5 VAL n 1 6 ASN n 1 7 CYS n 1 8 LYS n 1 9 THR n 1 10 ASP n 1 11 ARG n 1 12 ASP n 1 13 CYS n 1 14 VAL n 1 15 MET n 1 16 CYS n 1 17 GLY n 1 18 LEU n 1 19 GLY n 1 20 ILE n 1 21 SER n 1 22 CYS n 1 23 LYS n 1 24 ASN n 1 25 GLY n 1 26 TYR n 1 27 CYS n 1 28 GLN n 1 29 GLY n 1 30 CYS n 1 31 THR n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This sequence occurs naturally in the Chinese Scorpion Buthus martensi Karsch' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 THR 31 31 31 THR THR A . n # _exptl.entry_id 1RJI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1RJI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1RJI _struct.title 'Solution Structure of BmKX, a novel potassium channel blocker from the Chinese Scorpion Buthus martensi Karsch' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1RJI _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text '3-10 helix, beta sheet, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCKI_MESMA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TPYPVNCKTDRDCVMCGLGISCKNGYCQGCT _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_accession Q7Z0H4 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RJI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7Z0H4 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 54 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 9 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 14 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 9 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 14 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 7 A CYS 22 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 13 A CYS 27 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 16 A CYS 30 1_555 ? ? ? ? ? ? ? 2.029 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 7 ? CYS A 22 ? CYS A 7 ? 1_555 CYS A 22 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 13 ? CYS A 27 ? CYS A 13 ? 1_555 CYS A 27 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 16 ? CYS A 30 ? CYS A 16 ? 1_555 CYS A 30 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 1RJI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LYS 23 ? ? H A GLY 25 ? ? 1.59 2 2 O A LYS 23 ? ? H A GLY 25 ? ? 1.56 3 3 O A LYS 23 ? ? H A GLY 25 ? ? 1.59 4 4 O A LYS 23 ? ? H A GLY 25 ? ? 1.57 5 5 O A LYS 23 ? ? H A GLY 25 ? ? 1.57 6 6 O A LYS 23 ? ? H A GLY 25 ? ? 1.58 7 7 O A LYS 23 ? ? H A GLY 25 ? ? 1.59 8 8 O A LYS 23 ? ? H A GLY 25 ? ? 1.56 9 9 O A LYS 23 ? ? H A GLY 25 ? ? 1.57 10 10 O A LYS 23 ? ? H A GLY 25 ? ? 1.56 11 11 O A LYS 23 ? ? H A GLY 25 ? ? 1.58 12 12 O A LYS 23 ? ? H A GLY 25 ? ? 1.57 13 13 O A LYS 23 ? ? H A GLY 25 ? ? 1.58 14 14 O A LYS 23 ? ? H A GLY 25 ? ? 1.58 15 15 O A LYS 23 ? ? H A GLY 25 ? ? 1.58 16 16 O A LYS 23 ? ? H A GLY 25 ? ? 1.58 17 17 O A LYS 23 ? ? H A GLY 25 ? ? 1.57 18 18 O A LYS 23 ? ? H A GLY 25 ? ? 1.57 19 19 O A LYS 23 ? ? H A GLY 25 ? ? 1.59 20 20 O A LYS 23 ? ? H A GLY 25 ? ? 1.59 21 21 O A LYS 23 ? ? H A GLY 25 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -84.46 40.64 2 1 TYR A 3 ? ? -90.41 -60.62 3 1 LYS A 23 ? ? -94.62 -158.35 4 1 ASN A 24 ? ? -56.42 65.72 5 1 CYS A 30 ? ? -78.98 -128.79 6 2 PRO A 2 ? ? -81.39 43.73 7 2 LYS A 23 ? ? -95.11 -155.73 8 2 ASN A 24 ? ? -53.64 64.08 9 2 CYS A 30 ? ? -80.71 -128.20 10 3 PRO A 2 ? ? -82.62 42.27 11 3 LYS A 23 ? ? -94.90 -156.92 12 3 ASN A 24 ? ? -57.01 66.02 13 3 CYS A 30 ? ? -79.63 -126.45 14 4 PRO A 2 ? ? -81.40 41.62 15 4 LYS A 23 ? ? -95.38 -157.50 16 4 ASN A 24 ? ? -55.08 64.87 17 4 CYS A 30 ? ? -40.24 90.31 18 5 PRO A 2 ? ? -82.83 43.33 19 5 LYS A 23 ? ? -99.46 -154.71 20 5 ASN A 24 ? ? -50.14 63.83 21 5 CYS A 30 ? ? -80.93 -127.66 22 6 PRO A 2 ? ? -83.10 42.48 23 6 LYS A 23 ? ? -95.05 -155.73 24 6 ASN A 24 ? ? -54.97 65.21 25 6 CYS A 30 ? ? -81.15 -127.96 26 7 PRO A 2 ? ? -82.65 41.12 27 7 ARG A 11 ? ? -69.30 0.57 28 7 LYS A 23 ? ? -95.18 -157.41 29 7 ASN A 24 ? ? -56.69 65.62 30 7 CYS A 30 ? ? -81.46 -127.82 31 8 PRO A 2 ? ? -83.14 40.52 32 8 LYS A 23 ? ? -95.10 -155.42 33 8 ASN A 24 ? ? -54.28 65.02 34 8 CYS A 30 ? ? -80.77 -128.43 35 9 PRO A 2 ? ? -82.60 40.47 36 9 LYS A 23 ? ? -99.15 -154.49 37 9 ASN A 24 ? ? -50.82 64.27 38 9 CYS A 30 ? ? -81.75 -128.78 39 10 PRO A 2 ? ? -82.19 43.71 40 10 ARG A 11 ? ? -69.10 1.96 41 10 LYS A 23 ? ? -94.94 -156.05 42 10 ASN A 24 ? ? -55.41 65.23 43 10 CYS A 30 ? ? -80.28 -127.53 44 11 PRO A 2 ? ? -82.20 36.57 45 11 LYS A 23 ? ? -94.81 -156.07 46 11 ASN A 24 ? ? -55.56 64.71 47 11 CYS A 30 ? ? -82.51 -127.39 48 12 PRO A 2 ? ? -83.14 42.74 49 12 LYS A 23 ? ? -94.93 -155.48 50 12 ASN A 24 ? ? -55.30 65.13 51 12 CYS A 30 ? ? -81.95 -128.51 52 13 PRO A 2 ? ? -84.82 42.55 53 13 LYS A 23 ? ? -95.29 -157.01 54 13 ASN A 24 ? ? -56.00 65.76 55 13 CYS A 30 ? ? -81.86 -128.70 56 14 PRO A 2 ? ? -69.17 62.02 57 14 LYS A 23 ? ? -94.70 -154.91 58 14 ASN A 24 ? ? -54.95 65.17 59 14 CYS A 30 ? ? -79.58 -127.21 60 15 PRO A 2 ? ? -80.83 44.52 61 15 LYS A 23 ? ? -95.48 -156.74 62 15 ASN A 24 ? ? -54.07 64.69 63 15 CYS A 30 ? ? -79.00 -127.33 64 16 PRO A 2 ? ? -81.45 42.58 65 16 LYS A 23 ? ? -96.58 -155.49 66 16 ASN A 24 ? ? -52.77 65.43 67 16 CYS A 30 ? ? -80.86 -128.24 68 17 PRO A 2 ? ? -82.54 40.85 69 17 LYS A 23 ? ? -95.04 -155.50 70 17 ASN A 24 ? ? -54.05 64.95 71 17 CYS A 30 ? ? -80.76 -128.32 72 18 PRO A 2 ? ? -82.61 41.04 73 18 LYS A 23 ? ? -96.32 -152.66 74 18 ASN A 24 ? ? -51.97 64.62 75 18 CYS A 30 ? ? -80.83 -128.42 76 19 PRO A 2 ? ? -79.11 49.44 77 19 LYS A 23 ? ? -95.10 -156.72 78 19 ASN A 24 ? ? -56.67 65.90 79 19 CYS A 30 ? ? -40.91 90.55 80 20 PRO A 2 ? ? -82.90 42.00 81 20 LYS A 23 ? ? -94.03 -159.25 82 20 ASN A 24 ? ? -58.01 66.67 83 20 CYS A 30 ? ? -80.15 -128.11 84 21 ARG A 11 ? ? -69.27 3.18 85 21 LYS A 23 ? ? -95.30 -157.35 86 21 ASN A 24 ? ? -56.12 65.54 87 21 CYS A 30 ? ? -86.01 -130.63 # _pdbx_nmr_ensemble.entry_id 1RJI _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RJI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 'Phosphate buffer pH 5.0; 3mM BmKX' '90% H2O/10% D2O' 2 'Phosphate buffer pH 5.0; 3mM BmKX' '99.96% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 1 5.0 '50mM phosphate' atm K 2 300 1 5.0 '50mM phosphate' atm K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 DQF-COSY 2 1 1 '2D TOCSY' 3 1 1 '2D NOESY' 4 2 2 '2D TOCSY' 5 2 2 E-COSY 6 2 2 '2D NOESY' # _pdbx_nmr_details.entry_id 1RJI _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_refine.entry_id 1RJI _pdbx_nmr_refine.method 'simulated annealing and energy minimization' _pdbx_nmr_refine.details ;the structures are based on a total of 283 restraints, 245 are NOE-derived distance constraints, 19 dihedral angle restraints,19 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XEASY 3.2 'data analysis' 'K. Wuthrich' 1 DIANA 2.8 'data analysis' 'K. Wuthrich' 2 CNS 1.0 'structure solution' 'Brunger, A.T.' 3 CNS 1.0 refinement 'Brunger, A.T.' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLY N N N N 95 GLY CA C N N 96 GLY C C N N 97 GLY O O N N 98 GLY OXT O N N 99 GLY H H N N 100 GLY H2 H N N 101 GLY HA2 H N N 102 GLY HA3 H N N 103 GLY HXT H N N 104 ILE N N N N 105 ILE CA C N S 106 ILE C C N N 107 ILE O O N N 108 ILE CB C N S 109 ILE CG1 C N N 110 ILE CG2 C N N 111 ILE CD1 C N N 112 ILE OXT O N N 113 ILE H H N N 114 ILE H2 H N N 115 ILE HA H N N 116 ILE HB H N N 117 ILE HG12 H N N 118 ILE HG13 H N N 119 ILE HG21 H N N 120 ILE HG22 H N N 121 ILE HG23 H N N 122 ILE HD11 H N N 123 ILE HD12 H N N 124 ILE HD13 H N N 125 ILE HXT H N N 126 LEU N N N N 127 LEU CA C N S 128 LEU C C N N 129 LEU O O N N 130 LEU CB C N N 131 LEU CG C N N 132 LEU CD1 C N N 133 LEU CD2 C N N 134 LEU OXT O N N 135 LEU H H N N 136 LEU H2 H N N 137 LEU HA H N N 138 LEU HB2 H N N 139 LEU HB3 H N N 140 LEU HG H N N 141 LEU HD11 H N N 142 LEU HD12 H N N 143 LEU HD13 H N N 144 LEU HD21 H N N 145 LEU HD22 H N N 146 LEU HD23 H N N 147 LEU HXT H N N 148 LYS N N N N 149 LYS CA C N S 150 LYS C C N N 151 LYS O O N N 152 LYS CB C N N 153 LYS CG C N N 154 LYS CD C N N 155 LYS CE C N N 156 LYS NZ N N N 157 LYS OXT O N N 158 LYS H H N N 159 LYS H2 H N N 160 LYS HA H N N 161 LYS HB2 H N N 162 LYS HB3 H N N 163 LYS HG2 H N N 164 LYS HG3 H N N 165 LYS HD2 H N N 166 LYS HD3 H N N 167 LYS HE2 H N N 168 LYS HE3 H N N 169 LYS HZ1 H N N 170 LYS HZ2 H N N 171 LYS HZ3 H N N 172 LYS HXT H N N 173 MET N N N N 174 MET CA C N S 175 MET C C N N 176 MET O O N N 177 MET CB C N N 178 MET CG C N N 179 MET SD S N N 180 MET CE C N N 181 MET OXT O N N 182 MET H H N N 183 MET H2 H N N 184 MET HA H N N 185 MET HB2 H N N 186 MET HB3 H N N 187 MET HG2 H N N 188 MET HG3 H N N 189 MET HE1 H N N 190 MET HE2 H N N 191 MET HE3 H N N 192 MET HXT H N N 193 PRO N N N N 194 PRO CA C N S 195 PRO C C N N 196 PRO O O N N 197 PRO CB C N N 198 PRO CG C N N 199 PRO CD C N N 200 PRO OXT O N N 201 PRO H H N N 202 PRO HA H N N 203 PRO HB2 H N N 204 PRO HB3 H N N 205 PRO HG2 H N N 206 PRO HG3 H N N 207 PRO HD2 H N N 208 PRO HD3 H N N 209 PRO HXT H N N 210 SER N N N N 211 SER CA C N S 212 SER C C N N 213 SER O O N N 214 SER CB C N N 215 SER OG O N N 216 SER OXT O N N 217 SER H H N N 218 SER H2 H N N 219 SER HA H N N 220 SER HB2 H N N 221 SER HB3 H N N 222 SER HG H N N 223 SER HXT H N N 224 THR N N N N 225 THR CA C N S 226 THR C C N N 227 THR O O N N 228 THR CB C N R 229 THR OG1 O N N 230 THR CG2 C N N 231 THR OXT O N N 232 THR H H N N 233 THR H2 H N N 234 THR HA H N N 235 THR HB H N N 236 THR HG1 H N N 237 THR HG21 H N N 238 THR HG22 H N N 239 THR HG23 H N N 240 THR HXT H N N 241 TYR N N N N 242 TYR CA C N S 243 TYR C C N N 244 TYR O O N N 245 TYR CB C N N 246 TYR CG C Y N 247 TYR CD1 C Y N 248 TYR CD2 C Y N 249 TYR CE1 C Y N 250 TYR CE2 C Y N 251 TYR CZ C Y N 252 TYR OH O N N 253 TYR OXT O N N 254 TYR H H N N 255 TYR H2 H N N 256 TYR HA H N N 257 TYR HB2 H N N 258 TYR HB3 H N N 259 TYR HD1 H N N 260 TYR HD2 H N N 261 TYR HE1 H N N 262 TYR HE2 H N N 263 TYR HH H N N 264 TYR HXT H N N 265 VAL N N N N 266 VAL CA C N S 267 VAL C C N N 268 VAL O O N N 269 VAL CB C N N 270 VAL CG1 C N N 271 VAL CG2 C N N 272 VAL OXT O N N 273 VAL H H N N 274 VAL H2 H N N 275 VAL HA H N N 276 VAL HB H N N 277 VAL HG11 H N N 278 VAL HG12 H N N 279 VAL HG13 H N N 280 VAL HG21 H N N 281 VAL HG22 H N N 282 VAL HG23 H N N 283 VAL HXT H N N 284 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLY N CA sing N N 90 GLY N H sing N N 91 GLY N H2 sing N N 92 GLY CA C sing N N 93 GLY CA HA2 sing N N 94 GLY CA HA3 sing N N 95 GLY C O doub N N 96 GLY C OXT sing N N 97 GLY OXT HXT sing N N 98 ILE N CA sing N N 99 ILE N H sing N N 100 ILE N H2 sing N N 101 ILE CA C sing N N 102 ILE CA CB sing N N 103 ILE CA HA sing N N 104 ILE C O doub N N 105 ILE C OXT sing N N 106 ILE CB CG1 sing N N 107 ILE CB CG2 sing N N 108 ILE CB HB sing N N 109 ILE CG1 CD1 sing N N 110 ILE CG1 HG12 sing N N 111 ILE CG1 HG13 sing N N 112 ILE CG2 HG21 sing N N 113 ILE CG2 HG22 sing N N 114 ILE CG2 HG23 sing N N 115 ILE CD1 HD11 sing N N 116 ILE CD1 HD12 sing N N 117 ILE CD1 HD13 sing N N 118 ILE OXT HXT sing N N 119 LEU N CA sing N N 120 LEU N H sing N N 121 LEU N H2 sing N N 122 LEU CA C sing N N 123 LEU CA CB sing N N 124 LEU CA HA sing N N 125 LEU C O doub N N 126 LEU C OXT sing N N 127 LEU CB CG sing N N 128 LEU CB HB2 sing N N 129 LEU CB HB3 sing N N 130 LEU CG CD1 sing N N 131 LEU CG CD2 sing N N 132 LEU CG HG sing N N 133 LEU CD1 HD11 sing N N 134 LEU CD1 HD12 sing N N 135 LEU CD1 HD13 sing N N 136 LEU CD2 HD21 sing N N 137 LEU CD2 HD22 sing N N 138 LEU CD2 HD23 sing N N 139 LEU OXT HXT sing N N 140 LYS N CA sing N N 141 LYS N H sing N N 142 LYS N H2 sing N N 143 LYS CA C sing N N 144 LYS CA CB sing N N 145 LYS CA HA sing N N 146 LYS C O doub N N 147 LYS C OXT sing N N 148 LYS CB CG sing N N 149 LYS CB HB2 sing N N 150 LYS CB HB3 sing N N 151 LYS CG CD sing N N 152 LYS CG HG2 sing N N 153 LYS CG HG3 sing N N 154 LYS CD CE sing N N 155 LYS CD HD2 sing N N 156 LYS CD HD3 sing N N 157 LYS CE NZ sing N N 158 LYS CE HE2 sing N N 159 LYS CE HE3 sing N N 160 LYS NZ HZ1 sing N N 161 LYS NZ HZ2 sing N N 162 LYS NZ HZ3 sing N N 163 LYS OXT HXT sing N N 164 MET N CA sing N N 165 MET N H sing N N 166 MET N H2 sing N N 167 MET CA C sing N N 168 MET CA CB sing N N 169 MET CA HA sing N N 170 MET C O doub N N 171 MET C OXT sing N N 172 MET CB CG sing N N 173 MET CB HB2 sing N N 174 MET CB HB3 sing N N 175 MET CG SD sing N N 176 MET CG HG2 sing N N 177 MET CG HG3 sing N N 178 MET SD CE sing N N 179 MET CE HE1 sing N N 180 MET CE HE2 sing N N 181 MET CE HE3 sing N N 182 MET OXT HXT sing N N 183 PRO N CA sing N N 184 PRO N CD sing N N 185 PRO N H sing N N 186 PRO CA C sing N N 187 PRO CA CB sing N N 188 PRO CA HA sing N N 189 PRO C O doub N N 190 PRO C OXT sing N N 191 PRO CB CG sing N N 192 PRO CB HB2 sing N N 193 PRO CB HB3 sing N N 194 PRO CG CD sing N N 195 PRO CG HG2 sing N N 196 PRO CG HG3 sing N N 197 PRO CD HD2 sing N N 198 PRO CD HD3 sing N N 199 PRO OXT HXT sing N N 200 SER N CA sing N N 201 SER N H sing N N 202 SER N H2 sing N N 203 SER CA C sing N N 204 SER CA CB sing N N 205 SER CA HA sing N N 206 SER C O doub N N 207 SER C OXT sing N N 208 SER CB OG sing N N 209 SER CB HB2 sing N N 210 SER CB HB3 sing N N 211 SER OG HG sing N N 212 SER OXT HXT sing N N 213 THR N CA sing N N 214 THR N H sing N N 215 THR N H2 sing N N 216 THR CA C sing N N 217 THR CA CB sing N N 218 THR CA HA sing N N 219 THR C O doub N N 220 THR C OXT sing N N 221 THR CB OG1 sing N N 222 THR CB CG2 sing N N 223 THR CB HB sing N N 224 THR OG1 HG1 sing N N 225 THR CG2 HG21 sing N N 226 THR CG2 HG22 sing N N 227 THR CG2 HG23 sing N N 228 THR OXT HXT sing N N 229 TYR N CA sing N N 230 TYR N H sing N N 231 TYR N H2 sing N N 232 TYR CA C sing N N 233 TYR CA CB sing N N 234 TYR CA HA sing N N 235 TYR C O doub N N 236 TYR C OXT sing N N 237 TYR CB CG sing N N 238 TYR CB HB2 sing N N 239 TYR CB HB3 sing N N 240 TYR CG CD1 doub Y N 241 TYR CG CD2 sing Y N 242 TYR CD1 CE1 sing Y N 243 TYR CD1 HD1 sing N N 244 TYR CD2 CE2 doub Y N 245 TYR CD2 HD2 sing N N 246 TYR CE1 CZ doub Y N 247 TYR CE1 HE1 sing N N 248 TYR CE2 CZ sing Y N 249 TYR CE2 HE2 sing N N 250 TYR CZ OH sing N N 251 TYR OH HH sing N N 252 TYR OXT HXT sing N N 253 VAL N CA sing N N 254 VAL N H sing N N 255 VAL N H2 sing N N 256 VAL CA C sing N N 257 VAL CA CB sing N N 258 VAL CA HA sing N N 259 VAL C O doub N N 260 VAL C OXT sing N N 261 VAL CB CG1 sing N N 262 VAL CB CG2 sing N N 263 VAL CB HB sing N N 264 VAL CG1 HG11 sing N N 265 VAL CG1 HG12 sing N N 266 VAL CG1 HG13 sing N N 267 VAL CG2 HG21 sing N N 268 VAL CG2 HG22 sing N N 269 VAL CG2 HG23 sing N N 270 VAL OXT HXT sing N N 271 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1RJI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_