data_1RJT # _entry.id 1RJT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RJT pdb_00001rjt 10.2210/pdb1rjt/pdb RCSB RCSB020815 ? ? WWPDB D_1000020815 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-13 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' pdbx_entry_details 7 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RJT _pdbx_database_status.recvd_initial_deposition_date 2003-11-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Booth, V.' 1 'Clark-Lewis, I.' 2 'Sykes, B.D.' 3 # _citation.id primary _citation.title 'NMR structure of CXCR3 binding chemokine CXCL11 (ITAC).' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 13 _citation.page_first 2022 _citation.page_last 2028 _citation.year 2004 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15273303 _citation.pdbx_database_id_DOI 10.1110/ps.04791404 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Booth, V.' 1 ? primary 'Clark-Lewis, I.' 2 ? primary 'Sykes, B.D.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Small inducible cytokine B11' _entity.formula_weight 8324.064 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CXCL11, Interferon-inducible T-cell alpha chemoattractant, I-TAC, Interferon-gamma-inducible protein-9, IP-9, H174, Beta-R1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF _entity_poly.pdbx_seq_one_letter_code_can FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PHE n 1 2 PRO n 1 3 MET n 1 4 PHE n 1 5 LYS n 1 6 ARG n 1 7 GLY n 1 8 ARG n 1 9 CYS n 1 10 LEU n 1 11 CYS n 1 12 ILE n 1 13 GLY n 1 14 PRO n 1 15 GLY n 1 16 VAL n 1 17 LYS n 1 18 ALA n 1 19 VAL n 1 20 LYS n 1 21 VAL n 1 22 ALA n 1 23 ASP n 1 24 ILE n 1 25 GLU n 1 26 LYS n 1 27 ALA n 1 28 SER n 1 29 ILE n 1 30 MET n 1 31 TYR n 1 32 PRO n 1 33 SER n 1 34 ASN n 1 35 ASN n 1 36 CYS n 1 37 ASP n 1 38 LYS n 1 39 ILE n 1 40 GLU n 1 41 VAL n 1 42 ILE n 1 43 ILE n 1 44 THR n 1 45 LEU n 1 46 LYS n 1 47 GLU n 1 48 ASN n 1 49 LYS n 1 50 GLY n 1 51 GLN n 1 52 ARG n 1 53 CYS n 1 54 LEU n 1 55 ASN n 1 56 PRO n 1 57 LYS n 1 58 SER n 1 59 LYS n 1 60 GLN n 1 61 ALA n 1 62 ARG n 1 63 LEU n 1 64 ILE n 1 65 ILE n 1 66 LYS n 1 67 LYS n 1 68 VAL n 1 69 GLU n 1 70 ARG n 1 71 LYS n 1 72 ASN n 1 73 PHE n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'Synthesized with N15 isotope labels on all leucine and valine residues. Sequence is naturally found in Homo sapiens (human).' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PHE 1 1 1 PHE PHE A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 PHE 73 73 73 PHE PHE A . n # _exptl.entry_id 1RJT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1RJT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1RJT _struct.title 'NMR Structure of CXC Chemokine CXCL11/ITAC' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RJT _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text 'chemokine, CYTOKINE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCYBB_HUMAN _struct_ref.pdbx_db_accession O14625 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RJT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14625 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 73 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 60 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 69 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 60 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 69 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 9 A CYS 36 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 11 A CYS 53 1_555 ? ? ? ? ? ? ? 2.029 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 9 ? CYS A 36 ? CYS A 9 ? 1_555 CYS A 36 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 11 ? CYS A 53 ? CYS A 11 ? 1_555 CYS A 53 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 1RJT _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB A ILE 43 ? ? HB2 A ARG 52 ? ? 1.29 2 1 HA A LYS 26 ? ? HG23 A VAL 68 ? ? 1.34 3 1 HB3 A ALA 27 ? ? HG12 A ILE 43 ? ? 1.34 4 1 H A GLU 25 ? ? O A THR 44 ? ? 1.57 5 1 HZ2 A LYS 46 ? ? OE1 A GLU 47 ? ? 1.60 6 2 HB1 A ALA 27 ? ? HG12 A ILE 43 ? ? 1.29 7 2 HD13 A LEU 45 ? ? HD2 A LYS 49 ? ? 1.33 8 2 HZ3 A LYS 38 ? ? OE1 A GLU 40 ? ? 1.57 9 3 HB A ILE 43 ? ? HB2 A ARG 52 ? ? 1.32 10 3 H A GLU 25 ? ? O A THR 44 ? ? 1.58 11 5 HB A ILE 43 ? ? HB2 A ARG 52 ? ? 1.21 12 5 HD22 A LEU 45 ? ? HD3 A ARG 52 ? ? 1.26 13 5 HD21 A ASN 72 ? ? HD1 A PHE 73 ? ? 1.33 14 6 HB1 A ALA 27 ? ? HG12 A ILE 43 ? ? 1.31 15 6 HG13 A ILE 29 ? ? HD2 A TYR 31 ? ? 1.33 16 7 HG A SER 33 ? ? HG3 A GLU 40 ? ? 1.22 17 7 HB A ILE 43 ? ? HB2 A ARG 52 ? ? 1.23 18 7 HB1 A ALA 27 ? ? HG12 A ILE 43 ? ? 1.29 19 7 HG13 A ILE 12 ? ? H A GLY 13 ? ? 1.31 20 7 HZ2 A LYS 38 ? ? OE1 A GLU 40 ? ? 1.55 21 8 HB A ILE 43 ? ? HB2 A ARG 52 ? ? 1.13 22 8 H A GLU 25 ? ? O A THR 44 ? ? 1.59 23 9 HB1 A ALA 27 ? ? HG12 A ILE 43 ? ? 1.32 24 10 HB1 A ALA 27 ? ? HG12 A ILE 43 ? ? 1.16 25 10 HB A ILE 43 ? ? HB2 A ARG 52 ? ? 1.31 26 10 H A GLU 25 ? ? O A THR 44 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 4 ? ? 61.36 99.89 2 1 CYS A 9 ? ? -109.71 58.83 3 1 PRO A 14 ? ? -84.66 35.39 4 1 VAL A 16 ? ? -123.49 -124.65 5 1 LYS A 17 ? ? -176.72 110.35 6 1 ALA A 18 ? ? 69.19 96.74 7 1 VAL A 19 ? ? -130.94 -155.69 8 1 LYS A 20 ? ? -69.10 92.78 9 1 ALA A 22 ? ? -179.95 -26.12 10 1 GLU A 25 ? ? 68.71 72.50 11 1 PRO A 32 ? ? -56.80 21.83 12 1 SER A 33 ? ? 56.01 14.46 13 1 ASN A 35 ? ? -165.14 8.72 14 1 ASN A 48 ? ? -134.23 -55.34 15 1 ARG A 52 ? ? -150.16 82.91 16 1 ASN A 55 ? ? -156.64 -50.41 17 1 LYS A 57 ? ? 73.83 -72.28 18 1 GLN A 60 ? ? 66.13 -11.59 19 1 LYS A 71 ? ? 64.30 -176.47 20 2 LYS A 5 ? ? -144.35 -76.06 21 2 CYS A 11 ? ? -107.58 -75.60 22 2 ILE A 12 ? ? 69.87 117.13 23 2 PRO A 14 ? ? -81.24 38.48 24 2 VAL A 16 ? ? -114.21 -157.53 25 2 LYS A 17 ? ? -176.38 95.34 26 2 ALA A 18 ? ? -161.76 -154.80 27 2 VAL A 19 ? ? 50.49 -164.72 28 2 VAL A 21 ? ? -74.09 39.21 29 2 ALA A 22 ? ? -151.32 -41.90 30 2 GLU A 25 ? ? 69.34 74.65 31 2 MET A 30 ? ? -150.35 75.98 32 2 PRO A 32 ? ? -55.90 17.85 33 2 ASN A 35 ? ? -150.53 15.23 34 2 GLU A 47 ? ? -97.50 -81.03 35 2 LYS A 49 ? ? -114.07 -163.02 36 2 LEU A 54 ? ? -116.97 -83.14 37 2 LYS A 57 ? ? -149.50 -69.88 38 3 ARG A 8 ? ? -154.26 -54.66 39 3 VAL A 16 ? ? 60.09 -141.50 40 3 LYS A 17 ? ? 71.13 -45.48 41 3 ALA A 18 ? ? 74.56 132.56 42 3 VAL A 19 ? ? -112.23 -143.65 43 3 LYS A 20 ? ? -69.98 97.41 44 3 VAL A 21 ? ? -68.75 66.46 45 3 ALA A 22 ? ? -178.12 -34.32 46 3 GLU A 25 ? ? 58.53 72.49 47 3 LYS A 26 ? ? -151.50 89.60 48 3 MET A 30 ? ? -150.54 77.16 49 3 PRO A 32 ? ? -75.07 35.63 50 3 SER A 33 ? ? 59.74 7.12 51 3 ASN A 35 ? ? -161.04 10.75 52 3 ASP A 37 ? ? 68.85 -15.74 53 3 GLU A 47 ? ? 173.18 -58.73 54 3 LYS A 49 ? ? -131.74 -61.89 55 4 ARG A 6 ? ? 70.17 -69.98 56 4 PRO A 14 ? ? -90.65 31.95 57 4 ALA A 18 ? ? -172.14 114.68 58 4 VAL A 19 ? ? -176.17 -156.82 59 4 ALA A 22 ? ? 84.90 -2.64 60 4 GLU A 25 ? ? 64.29 73.54 61 4 MET A 30 ? ? -150.73 78.38 62 4 PRO A 32 ? ? -70.57 48.07 63 4 SER A 33 ? ? 56.48 12.44 64 4 LYS A 49 ? ? 71.15 133.30 65 4 LEU A 54 ? ? -98.49 45.49 66 4 ASN A 55 ? ? -141.06 59.59 67 4 LYS A 57 ? ? -173.50 -53.86 68 5 PHE A 4 ? ? -143.75 -31.90 69 5 LYS A 5 ? ? 55.51 72.22 70 5 ARG A 6 ? ? 60.65 -168.26 71 5 LEU A 10 ? ? 75.21 89.86 72 5 LYS A 17 ? ? -174.10 -35.58 73 5 ALA A 18 ? ? 73.37 109.97 74 5 VAL A 19 ? ? -130.46 -153.45 75 5 VAL A 21 ? ? -64.21 74.91 76 5 ALA A 22 ? ? 169.30 -39.45 77 5 GLU A 25 ? ? 63.84 73.60 78 5 SER A 28 ? ? -116.97 66.73 79 5 MET A 30 ? ? -150.78 76.19 80 5 PRO A 32 ? ? -60.26 55.14 81 5 SER A 33 ? ? 66.07 -66.76 82 5 ASN A 34 ? ? 170.16 -29.46 83 5 ASN A 35 ? ? -145.05 45.91 84 5 LYS A 46 ? ? -157.26 -100.00 85 5 GLU A 47 ? ? -150.27 -70.09 86 5 PRO A 56 ? ? -63.59 -162.32 87 5 LYS A 57 ? ? 67.16 93.36 88 6 PRO A 2 ? ? -74.76 -162.97 89 6 MET A 3 ? ? -146.30 -48.20 90 6 PHE A 4 ? ? 66.29 96.95 91 6 LYS A 5 ? ? 64.14 -164.18 92 6 ARG A 6 ? ? 73.08 -52.79 93 6 ARG A 8 ? ? -130.62 -65.03 94 6 PRO A 14 ? ? -99.76 41.68 95 6 ALA A 18 ? ? -170.81 134.84 96 6 VAL A 19 ? ? -123.69 -141.06 97 6 VAL A 21 ? ? -73.82 22.90 98 6 ALA A 22 ? ? -150.53 15.89 99 6 ASP A 23 ? ? -130.30 -60.08 100 6 GLU A 25 ? ? 60.89 74.28 101 6 ILE A 29 ? ? -161.09 116.31 102 6 MET A 30 ? ? -108.59 76.75 103 6 PRO A 32 ? ? -70.16 41.58 104 6 SER A 33 ? ? 55.88 11.35 105 6 LYS A 46 ? ? -157.58 -96.31 106 6 GLU A 47 ? ? -173.94 50.46 107 6 ASN A 48 ? ? 65.51 75.65 108 6 LYS A 49 ? ? -169.80 -58.76 109 6 ASN A 55 ? ? -163.11 87.03 110 6 LYS A 57 ? ? 178.47 158.16 111 6 LYS A 59 ? ? 58.12 75.23 112 7 VAL A 16 ? ? -90.13 -82.15 113 7 LYS A 17 ? ? -139.63 -87.83 114 7 ALA A 18 ? ? -178.75 144.00 115 7 VAL A 19 ? ? -138.17 -155.37 116 7 ALA A 22 ? ? -144.99 17.51 117 7 ASP A 23 ? ? -130.67 -58.98 118 7 GLU A 25 ? ? 71.24 74.99 119 7 SER A 28 ? ? -102.41 71.34 120 7 PRO A 32 ? ? -63.67 57.98 121 7 SER A 33 ? ? 44.63 18.29 122 7 ASN A 35 ? ? -162.69 15.26 123 7 GLU A 47 ? ? -178.71 -68.95 124 7 LYS A 57 ? ? 175.97 -40.63 125 8 PRO A 2 ? ? -61.43 98.56 126 8 PHE A 4 ? ? 62.40 -174.52 127 8 LYS A 5 ? ? 63.77 -170.03 128 8 ARG A 8 ? ? -131.04 -65.08 129 8 ILE A 12 ? ? 179.82 121.81 130 8 PRO A 14 ? ? -42.68 109.10 131 8 VAL A 16 ? ? 58.32 -176.86 132 8 LYS A 17 ? ? 66.89 91.62 133 8 VAL A 19 ? ? -138.56 -143.19 134 8 VAL A 21 ? ? -78.54 42.83 135 8 ALA A 22 ? ? -173.85 30.82 136 8 ASP A 23 ? ? -142.25 -66.18 137 8 GLU A 25 ? ? 63.94 72.59 138 8 PRO A 32 ? ? -49.65 171.12 139 8 SER A 33 ? ? -69.72 21.53 140 8 ASN A 34 ? ? 79.73 -6.43 141 8 ASN A 35 ? ? -141.01 17.29 142 8 ASP A 37 ? ? 58.94 7.72 143 8 LYS A 49 ? ? -164.33 -68.99 144 8 PRO A 56 ? ? -70.06 20.32 145 8 ARG A 70 ? ? -82.24 44.80 146 8 LYS A 71 ? ? -61.51 99.65 147 9 ARG A 6 ? ? 73.38 177.42 148 9 VAL A 16 ? ? -90.66 -82.32 149 9 LYS A 17 ? ? -171.61 -67.05 150 9 VAL A 19 ? ? -133.73 -157.44 151 9 LYS A 20 ? ? -68.68 94.02 152 9 ALA A 22 ? ? 171.74 -28.13 153 9 GLU A 25 ? ? 65.72 72.98 154 9 SER A 28 ? ? -105.60 70.06 155 9 MET A 30 ? ? -150.29 79.09 156 9 PRO A 32 ? ? -61.86 51.92 157 9 SER A 33 ? ? 65.92 -11.77 158 9 LYS A 46 ? ? -161.89 -75.23 159 9 GLU A 47 ? ? 175.21 -149.58 160 9 PRO A 56 ? ? -37.37 -21.73 161 10 ARG A 6 ? ? 68.43 -169.34 162 10 ARG A 8 ? ? 60.13 -104.67 163 10 LEU A 10 ? ? 84.70 161.22 164 10 CYS A 11 ? ? 62.17 131.89 165 10 ILE A 12 ? ? 174.68 148.39 166 10 PRO A 14 ? ? -65.99 95.19 167 10 VAL A 16 ? ? 44.66 111.97 168 10 ALA A 18 ? ? 65.31 91.81 169 10 VAL A 19 ? ? -108.31 -143.53 170 10 LYS A 20 ? ? -64.40 95.13 171 10 ASP A 23 ? ? -134.50 -50.06 172 10 GLU A 25 ? ? 60.29 71.04 173 10 PRO A 32 ? ? -63.53 43.03 174 10 SER A 33 ? ? 63.92 -3.22 175 10 LYS A 46 ? ? -104.53 -164.62 176 10 GLU A 47 ? ? 73.55 -51.85 177 10 LYS A 49 ? ? -136.17 -139.54 178 10 LYS A 59 ? ? 68.93 -69.79 179 10 GLN A 60 ? ? 68.78 -35.94 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 8 _pdbx_validate_peptide_omega.auth_comp_id_1 ILE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 24 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 25 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -146.00 # _pdbx_nmr_ensemble.entry_id 1RJT _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RJT _pdbx_nmr_representative.conformer_id 2 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2 mM CXCL11, partial N15' _pdbx_nmr_sample_details.solvent_system '20 mM deuterated sodium acetate, 1 mM sodium azide, 1 mM DSS, 90% H2O, 10% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 318 ambient 4.5 0 ? K 2 303 ambient 5.0 0 ? K 3 313 ambient 5.0 0 ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 3D_15N-separated_NOESY 4 1 1 DQF-COSY # _pdbx_nmr_details.entry_id 1RJT _pdbx_nmr_details.text 'Assignments were made for all three sample conditions. Structure was calculated using data from all three conditions.' # _pdbx_nmr_refine.entry_id 1RJT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.2 processing Delaglio 1 NMRView 5.0.4 'data analysis' Johnson 2 CNS 1.2 refinement Brunger 3 ARIA 1.2 refinement Nilges 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TYR N N N N 297 TYR CA C N S 298 TYR C C N N 299 TYR O O N N 300 TYR CB C N N 301 TYR CG C Y N 302 TYR CD1 C Y N 303 TYR CD2 C Y N 304 TYR CE1 C Y N 305 TYR CE2 C Y N 306 TYR CZ C Y N 307 TYR OH O N N 308 TYR OXT O N N 309 TYR H H N N 310 TYR H2 H N N 311 TYR HA H N N 312 TYR HB2 H N N 313 TYR HB3 H N N 314 TYR HD1 H N N 315 TYR HD2 H N N 316 TYR HE1 H N N 317 TYR HE2 H N N 318 TYR HH H N N 319 TYR HXT H N N 320 VAL N N N N 321 VAL CA C N S 322 VAL C C N N 323 VAL O O N N 324 VAL CB C N N 325 VAL CG1 C N N 326 VAL CG2 C N N 327 VAL OXT O N N 328 VAL H H N N 329 VAL H2 H N N 330 VAL HA H N N 331 VAL HB H N N 332 VAL HG11 H N N 333 VAL HG12 H N N 334 VAL HG13 H N N 335 VAL HG21 H N N 336 VAL HG22 H N N 337 VAL HG23 H N N 338 VAL HXT H N N 339 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1RJT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_