data_1RL5 # _entry.id 1RL5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RL5 pdb_00001rl5 10.2210/pdb1rl5/pdb RCSB RCSB020856 ? ? WWPDB D_1000020856 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 5989 _pdbx_database_related.details '1H chemical shifts and coupling constants' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RL5 _pdbx_database_status.recvd_initial_deposition_date 2003-11-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dubinnyi, M.A.' 1 'Pustovalova, Y.E.' 2 'Dubovskii, P.V.' 3 'Utkin, Y.N.' 4 'Arseniev, A.S.' 5 # _citation.id primary _citation.title 'Interaction of three-finger toxins with phospholipid membranes: comparison of S- and P-type cytotoxins.' _citation.journal_abbrev Biochem.J. _citation.journal_volume 387 _citation.page_first 807 _citation.page_last 815 _citation.year 2005 _citation.journal_id_ASTM BIJOAK _citation.country UK _citation.journal_id_ISSN 0264-6021 _citation.journal_id_CSD 0043 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15584897 _citation.pdbx_database_id_DOI 10.1042/BJ20041814 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dubovskii, P.V.' 1 ? primary 'Lesovoy, D.M.' 2 ? primary 'Dubinnyi, M.A.' 3 ? primary 'Konshina, A.G.' 4 ? primary 'Utkin, Y.N.' 5 ? primary 'Efremov, R.G.' 6 ? primary 'Arseniev, A.S.' 7 ? # _cell.entry_id 1RL5 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RL5 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Cytotoxin 1' 6831.339 1 ? ? ? ? 2 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LKCNKLVPIAYKTCPEGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN _entity_poly.pdbx_seq_one_letter_code_can LKCNKLVPIAYKTCPEGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 LYS n 1 3 CYS n 1 4 ASN n 1 5 LYS n 1 6 LEU n 1 7 VAL n 1 8 PRO n 1 9 ILE n 1 10 ALA n 1 11 TYR n 1 12 LYS n 1 13 THR n 1 14 CYS n 1 15 PRO n 1 16 GLU n 1 17 GLY n 1 18 LYS n 1 19 ASN n 1 20 LEU n 1 21 CYS n 1 22 TYR n 1 23 LYS n 1 24 MET n 1 25 PHE n 1 26 MET n 1 27 MET n 1 28 SER n 1 29 ASP n 1 30 LEU n 1 31 THR n 1 32 ILE n 1 33 PRO n 1 34 VAL n 1 35 LYS n 1 36 ARG n 1 37 GLY n 1 38 CYS n 1 39 ILE n 1 40 ASP n 1 41 VAL n 1 42 CYS n 1 43 PRO n 1 44 LYS n 1 45 ASN n 1 46 SER n 1 47 LEU n 1 48 LEU n 1 49 VAL n 1 50 LYS n 1 51 TYR n 1 52 VAL n 1 53 CYS n 1 54 CYS n 1 55 ASN n 1 56 THR n 1 57 ASP n 1 58 ARG n 1 59 CYS n 1 60 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Central Asian cobra' _entity_src_nat.pdbx_organism_scientific 'Naja oxiana' _entity_src_nat.pdbx_ncbi_taxonomy_id 8657 _entity_src_nat.genus Naja _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion venome _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CX1_NAJOX _struct_ref.pdbx_db_accession P01451 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LKCNKLVPIAYKTCPEGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RL5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01451 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 60 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 60 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 DQF-COSY 4 2 1 '2D NOESY' 5 2 1 '2D TOCSY' 6 2 1 DQF-COSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.pressure normal _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '20mM Cytotoxin I, 50mM KCl, H2O' 'KCl: 50mM, H2O' 2 '20mM Cytotoxin I, 50mM KCl, D2O' 'KCl: 50mM, D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1RL5 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details '478 NOE-derived constraints, 202 angular constraints, 186 constraints for 31 hydrogen bonds, 24 constraints for 4 SS-bonds' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1RL5 _pdbx_nmr_details.text ;Cytotoxin I major and minor conformational states (in ratio of 6:1) in aqueous solution, corresponding to trans and cis val7-pro8 peptide bond conformations, were established via NMR spectra analysis. Here is the obtained major structure of cytotoxin I. The presented at HETATM section HOH in each model are tightly bound water molecules (with longer than for bulk water lifetimes nearby protein), reaveled by NMR approach. The principle of apportionment of these water molecules differs from that in crystal structures, for which the water molecules being at the proximity to protein are indicated. ; # _pdbx_nmr_ensemble.entry_id 1RL5 _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RL5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.1.a collection ? 1 XwinNMR 3.1.a processing ? 2 XEASY 1.2.11 'data analysis' 'Bartels. C.' 3 CYANA 1.0.6 'structure solution' 'Guntert, P.' 4 NMRPipe 'April 12, 2001' processing 'Delagio, F.' 5 ACME 2001.085.20.47 'data analysis' 'Delagio, F.' 6 CYANA 1.0.6 refinement 'Guntert, P.' 7 # _exptl.entry_id 1RL5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1RL5 _struct.title 'NMR structure with tightly bound water molecule of cytotoxin I from Naja oxiana in aqueous solution (major form)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RL5 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'S-type cytotoxin, membrane perturbation, cis/trans isomerization, bound water, TOXIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 3 A CYS 21 1_555 ? ? ? ? ? ? ? 1.989 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 14 A CYS 38 1_555 ? ? ? ? ? ? ? 1.994 ? ? disulf3 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 42 A CYS 53 1_555 ? ? ? ? ? ? ? 1.993 ? ? disulf4 disulf ? ? A CYS 54 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 54 A CYS 59 1_555 ? ? ? ? ? ? ? 1.996 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 2 ? ASN A 4 ? LYS A 2 ASN A 4 A 2 TYR A 11 ? THR A 13 ? TYR A 11 THR A 13 B 1 LYS A 35 ? ILE A 39 ? LYS A 35 ILE A 39 B 2 LEU A 20 ? MET A 26 ? LEU A 20 MET A 26 B 3 VAL A 49 ? CYS A 54 ? VAL A 49 CYS A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 3 ? N CYS A 3 O LYS A 12 ? O LYS A 12 B 1 2 O ILE A 39 ? O ILE A 39 N LEU A 20 ? N LEU A 20 B 2 3 N CYS A 21 ? N CYS A 21 O CYS A 54 ? O CYS A 54 # _database_PDB_matrix.entry_id 1RL5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RL5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HOH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 61 _pdbx_nonpoly_scheme.auth_seq_num 61 _pdbx_nonpoly_scheme.pdb_mon_id HOH _pdbx_nonpoly_scheme.auth_mon_id HOH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-02-15 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 H A LYS 2 ? ? OD1 A ASP 57 ? ? 1.52 2 7 H A LYS 2 ? ? OD1 A ASP 57 ? ? 1.51 3 10 H A LYS 2 ? ? OD2 A ASP 57 ? ? 1.51 4 17 H A LYS 2 ? ? OD1 A ASP 57 ? ? 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 8 ? ? -60.16 10.99 2 1 PRO A 15 ? ? -47.66 165.22 3 1 SER A 28 ? ? -64.22 -96.30 4 1 PRO A 33 ? ? -45.91 167.74 5 1 ARG A 58 ? ? 39.22 40.09 6 2 PRO A 8 ? ? -61.42 9.79 7 2 PRO A 15 ? ? -48.03 165.01 8 2 SER A 28 ? ? -68.98 -99.64 9 2 PRO A 33 ? ? -48.61 152.62 10 2 ARG A 58 ? ? 38.09 41.16 11 3 PRO A 8 ? ? -60.11 10.85 12 3 PRO A 15 ? ? -48.25 170.40 13 3 ASN A 19 ? ? -145.50 -44.59 14 3 SER A 28 ? ? -72.70 -102.01 15 3 ARG A 58 ? ? 38.39 39.97 16 4 PRO A 8 ? ? -59.84 10.11 17 4 PRO A 15 ? ? -47.72 172.42 18 4 SER A 28 ? ? -64.25 -94.94 19 4 ARG A 58 ? ? 37.69 42.51 20 5 PRO A 8 ? ? -59.89 13.15 21 5 PRO A 15 ? ? -48.28 169.66 22 5 ASN A 19 ? ? -145.72 -40.90 23 5 SER A 28 ? ? -67.63 -96.76 24 5 PRO A 33 ? ? -47.38 170.93 25 5 ARG A 58 ? ? 38.20 37.93 26 6 LYS A 5 ? ? -95.03 -156.21 27 6 PRO A 8 ? ? -60.54 14.67 28 6 PRO A 15 ? ? -48.15 173.86 29 6 SER A 28 ? ? -71.23 -97.64 30 6 ARG A 58 ? ? 37.53 41.62 31 7 PRO A 8 ? ? -61.87 9.27 32 7 PRO A 15 ? ? -48.11 167.33 33 7 ASN A 19 ? ? -145.62 -44.05 34 7 SER A 28 ? ? -64.60 -89.18 35 7 ARG A 58 ? ? 38.03 39.68 36 8 PRO A 8 ? ? -60.03 12.30 37 8 PRO A 15 ? ? -48.62 166.76 38 8 ASN A 19 ? ? -145.63 -42.65 39 8 SER A 28 ? ? -66.09 -101.60 40 8 ARG A 58 ? ? 36.37 37.94 41 9 PRO A 8 ? ? -60.06 10.25 42 9 LYS A 12 ? ? -135.60 -159.94 43 9 PRO A 15 ? ? -48.45 176.21 44 9 ASN A 19 ? ? -145.49 -44.77 45 9 SER A 28 ? ? -65.34 -95.41 46 9 ARG A 58 ? ? 37.68 43.38 47 10 PRO A 8 ? ? -59.82 9.16 48 10 PRO A 15 ? ? -47.95 174.60 49 10 ASN A 19 ? ? -145.69 -44.04 50 10 SER A 28 ? ? -65.91 -100.18 51 10 PRO A 33 ? ? -49.59 163.28 52 10 ARG A 58 ? ? 38.26 38.00 53 11 PRO A 8 ? ? -61.61 9.90 54 11 PRO A 15 ? ? -48.24 169.53 55 11 ASN A 19 ? ? -145.55 -43.65 56 11 SER A 28 ? ? -69.03 -98.81 57 11 PRO A 33 ? ? -48.48 150.80 58 11 ARG A 58 ? ? 38.91 36.75 59 12 PRO A 8 ? ? -61.58 9.35 60 12 PRO A 15 ? ? -48.44 165.58 61 12 SER A 28 ? ? -69.04 -90.83 62 12 ARG A 58 ? ? 36.96 42.06 63 13 LYS A 5 ? ? -95.93 -157.96 64 13 PRO A 8 ? ? -61.83 9.63 65 13 PRO A 15 ? ? -48.99 171.29 66 13 ASN A 19 ? ? -146.06 -42.91 67 13 SER A 28 ? ? -70.72 -98.61 68 13 ARG A 58 ? ? 37.53 36.86 69 14 PRO A 8 ? ? -61.70 10.08 70 14 PRO A 15 ? ? -48.41 169.88 71 14 SER A 28 ? ? -75.35 -79.75 72 14 ARG A 58 ? ? 37.90 37.76 73 15 PRO A 8 ? ? -60.05 10.45 74 15 PRO A 15 ? ? -48.07 174.51 75 15 ASN A 19 ? ? -145.62 -43.54 76 15 SER A 28 ? ? -68.66 -98.11 77 15 ARG A 58 ? ? 36.36 45.13 78 16 PRO A 8 ? ? -60.21 11.58 79 16 PRO A 15 ? ? -48.09 169.11 80 16 SER A 28 ? ? -71.58 -97.77 81 16 PRO A 33 ? ? -45.70 155.02 82 16 ARG A 58 ? ? 37.00 44.01 83 17 PRO A 8 ? ? -60.59 9.64 84 17 PRO A 15 ? ? -48.13 171.72 85 17 ASN A 19 ? ? -145.66 -42.40 86 17 SER A 28 ? ? -73.46 -98.11 87 17 ARG A 58 ? ? 36.99 35.00 88 18 LYS A 5 ? ? -95.63 -158.25 89 18 PRO A 8 ? ? -61.00 14.31 90 18 PRO A 15 ? ? -47.65 175.02 91 18 SER A 28 ? ? -64.08 -97.72 92 18 ARG A 58 ? ? 37.96 44.26 93 19 PRO A 8 ? ? -61.64 10.05 94 19 PRO A 15 ? ? -48.91 177.95 95 19 ASN A 19 ? ? -145.65 -45.62 96 19 SER A 28 ? ? -70.44 -97.43 97 19 PRO A 33 ? ? -49.34 164.53 98 19 ARG A 58 ? ? 38.32 40.78 99 20 PRO A 8 ? ? -60.15 10.34 100 20 PRO A 15 ? ? -48.90 170.36 101 20 ASN A 19 ? ? -145.40 -41.35 102 20 SER A 28 ? ? -71.17 -98.57 103 20 ARG A 58 ? ? 37.00 39.36 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #