data_1ROT # _entry.id 1ROT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ROT pdb_00001rot 10.2210/pdb1rot/pdb WWPDB D_1000176167 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1ROU _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ROT _pdbx_database_status.recvd_initial_deposition_date 1996-06-14 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Craescu, C.T.' 1 'Rouviere, N.' 2 'Popescu, A.' 3 'Cerpolini, E.' 4 'Lebeau, M.-C.' 5 'Baulieu, E.-E.' 6 'Mispelter, J.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Three-dimensional structure of the immunophilin-like domain of FKBP59 in solution.' Biochemistry 35 11045 11052 1996 BICHAW US 0006-2960 0033 ? 8780506 10.1021/bi960975p 1 ;1H and 15N Assignment of NMR Spectrum, Secondary Structure and Global Folding of the Immunophilin-Like Domain of the 59-kDa Fk506-Binding Protein ; Eur.J.Biochem. 231 761 ? 1995 EJBCAI IX 0014-2956 0262 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Craescu, C.T.' 1 ? primary 'Rouviere, N.' 2 ? primary 'Popescu, A.' 3 ? primary 'Cerpolini, E.' 4 ? primary 'Lebeau, M.C.' 5 ? primary 'Baulieu, E.E.' 6 ? primary 'Mispelter, J.' 7 ? 1 'Rouviere-Fourmy, N.' 8 ? 1 'Craescu, C.T.' 9 ? 1 'Mispelter, J.' 10 ? 1 'Lebeau, M.C.' 11 ? 1 'Baulieu, E.E.' 12 ? # _cell.entry_id 1ROT _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ROT _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description FKBP59-I _entity.formula_weight 16259.305 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FKBP52 OR HSP56' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EEMDIKAAESGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDL GKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTDDEDGVP ; _entity_poly.pdbx_seq_one_letter_code_can ;EEMDIKAAESGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDL GKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTDDEDGVP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 MET n 1 4 ASP n 1 5 ILE n 1 6 LYS n 1 7 ALA n 1 8 ALA n 1 9 GLU n 1 10 SER n 1 11 GLY n 1 12 ALA n 1 13 GLN n 1 14 SER n 1 15 ALA n 1 16 PRO n 1 17 LEU n 1 18 PRO n 1 19 LEU n 1 20 GLU n 1 21 GLY n 1 22 VAL n 1 23 ASP n 1 24 ILE n 1 25 SER n 1 26 PRO n 1 27 LYS n 1 28 GLN n 1 29 ASP n 1 30 GLU n 1 31 GLY n 1 32 VAL n 1 33 LEU n 1 34 LYS n 1 35 VAL n 1 36 ILE n 1 37 LYS n 1 38 ARG n 1 39 GLU n 1 40 GLY n 1 41 THR n 1 42 GLY n 1 43 THR n 1 44 GLU n 1 45 THR n 1 46 PRO n 1 47 MET n 1 48 ILE n 1 49 GLY n 1 50 ASP n 1 51 ARG n 1 52 VAL n 1 53 PHE n 1 54 VAL n 1 55 HIS n 1 56 TYR n 1 57 THR n 1 58 GLY n 1 59 TRP n 1 60 LEU n 1 61 LEU n 1 62 ASP n 1 63 GLY n 1 64 THR n 1 65 LYS n 1 66 PHE n 1 67 ASP n 1 68 SER n 1 69 SER n 1 70 LEU n 1 71 ASP n 1 72 ARG n 1 73 LYS n 1 74 ASP n 1 75 LYS n 1 76 PHE n 1 77 SER n 1 78 PHE n 1 79 ASP n 1 80 LEU n 1 81 GLY n 1 82 LYS n 1 83 GLY n 1 84 GLU n 1 85 VAL n 1 86 ILE n 1 87 LYS n 1 88 ALA n 1 89 TRP n 1 90 ASP n 1 91 ILE n 1 92 ALA n 1 93 VAL n 1 94 ALA n 1 95 THR n 1 96 MET n 1 97 LYS n 1 98 VAL n 1 99 GLY n 1 100 GLU n 1 101 LEU n 1 102 CYS n 1 103 ARG n 1 104 ILE n 1 105 THR n 1 106 CYS n 1 107 LYS n 1 108 PRO n 1 109 GLU n 1 110 TYR n 1 111 ALA n 1 112 TYR n 1 113 GLY n 1 114 SER n 1 115 ALA n 1 116 GLY n 1 117 SER n 1 118 PRO n 1 119 PRO n 1 120 LYS n 1 121 ILE n 1 122 PRO n 1 123 PRO n 1 124 ASN n 1 125 ALA n 1 126 THR n 1 127 LEU n 1 128 VAL n 1 129 PHE n 1 130 GLU n 1 131 VAL n 1 132 GLU n 1 133 LEU n 1 134 PHE n 1 135 GLU n 1 136 PHE n 1 137 LYS n 1 138 GLY n 1 139 GLU n 1 140 ASP n 1 141 LEU n 1 142 THR n 1 143 ASP n 1 144 ASP n 1 145 GLU n 1 146 ASP n 1 147 GLY n 1 148 VAL n 1 149 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name rabbit _entity_src_gen.gene_src_genus Oryctolagus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oryctolagus cuniculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9986 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ LIVER _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FKBP4_RABIT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P27124 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;TAEEMKAAESGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDL GKGEVIKAWDIAVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTDDEDGGIIRRIRTRGEGY ARPNDGAIVEVALEGYYKDRLFDQRELRFEVGEGESLDLPCGLEKAIQRMEKGEHSILYLKPSYAFGNAGKEKFQIPPYA ELKYEVHLKSFEKAKESWEMSSEEKLEQSAIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSSEEVQKAQALRLAS HLNLAMCHLKLQAFSAAVESCNKALELDSNNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKAQLAVCQQRIR KQIAREKKLYANMFERLAEEENKAKAEVAAGDHPMDTEMKDERNDVAGSQSQVETEA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ROT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P27124 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 147 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1ROT ASP A 4 ? UNP P27124 ? ? insertion 4 1 1 1ROT ILE A 5 ? UNP P27124 ? ? insertion 5 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_refine.entry_id 1ROT _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details 'CVFF OF DISCOVER (BIOSYM)' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1ROT _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'MINIMIZED AVERAGE' # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name Discover _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BIOSYM _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1ROT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ROT _struct.title 'STRUCTURE OF FKBP59-I, THE N-TERMINAL DOMAIN OF A 59 KDA FK506-BINDING PROTEIN, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ROT _struct_keywords.pdbx_keywords 'ROTAMASE (ISOMERASE)' _struct_keywords.text 'ROTAMASE (ISOMERASE), DOMAIN I (N-TERM) OF A 59 KDA, FK506-BINDING PROTEIN, PEPTIDYL PROLYL CIS-TRANS ISOMERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 87 ? THR A 95 ? LYS A 87 THR A 95 1 ? 9 HELX_P HELX_P2 2 PRO A 108 ? TYR A 110 ? PRO A 108 TYR A 110 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A1 ? 6 ? A2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A1 1 2 ? anti-parallel A1 2 3 ? anti-parallel A1 3 4 ? anti-parallel A1 4 5 ? anti-parallel A1 5 6 ? anti-parallel A2 1 2 ? anti-parallel A2 2 3 ? anti-parallel A2 3 4 ? anti-parallel A2 4 5 ? anti-parallel A2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A1 1 VAL A 22 ? ILE A 24 ? VAL A 22 ILE A 24 A1 2 VAL A 32 ? LYS A 37 ? VAL A 32 LYS A 37 A1 3 LEU A 101 ? LYS A 107 ? LEU A 101 LYS A 107 A1 4 LEU A 127 ? LYS A 137 ? LEU A 127 LYS A 137 A1 5 ASP A 50 ? LEU A 60 ? ASP A 50 LEU A 60 A1 6 THR A 64 ? SER A 68 ? THR A 64 SER A 68 A2 1 VAL A 22 ? ILE A 24 ? VAL A 22 ILE A 24 A2 2 VAL A 32 ? LYS A 37 ? VAL A 32 LYS A 37 A2 3 LEU A 101 ? LYS A 107 ? LEU A 101 LYS A 107 A2 4 LEU A 127 ? LYS A 137 ? LEU A 127 LYS A 137 A2 5 ASP A 50 ? LEU A 60 ? ASP A 50 LEU A 60 A2 6 PHE A 76 ? LEU A 80 ? PHE A 76 LEU A 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A1 1 2 O ILE A 24 ? O ILE A 24 N VAL A 32 ? N VAL A 32 A1 2 3 O VAL A 35 ? O VAL A 35 N ARG A 103 ? N ARG A 103 A1 3 4 O CYS A 106 ? O CYS A 106 N LEU A 127 ? N LEU A 127 A1 4 5 N VAL A 128 ? N VAL A 128 O TRP A 59 ? O TRP A 59 A1 5 6 N LEU A 60 ? N LEU A 60 O THR A 64 ? O THR A 64 A2 1 2 O ILE A 24 ? O ILE A 24 N VAL A 32 ? N VAL A 32 A2 2 3 O VAL A 35 ? O VAL A 35 N ARG A 103 ? N ARG A 103 A2 3 4 O CYS A 106 ? O CYS A 106 N LEU A 127 ? N LEU A 127 A2 4 5 N VAL A 128 ? N VAL A 128 O TRP A 59 ? O TRP A 59 A2 5 6 N VAL A 54 ? N VAL A 54 O PHE A 76 ? O PHE A 76 # _database_PDB_matrix.entry_id 1ROT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ROT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 MET 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 ILE 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 ALA 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 GLY 11 11 ? ? ? A . n A 1 12 ALA 12 12 ? ? ? A . n A 1 13 GLN 13 13 ? ? ? A . n A 1 14 SER 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 LEU 17 17 ? ? ? A . n A 1 18 PRO 18 18 ? ? ? A . n A 1 19 LEU 19 19 ? ? ? A . n A 1 20 GLU 20 20 ? ? ? A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 GLU 139 139 ? ? ? A . n A 1 140 ASP 140 140 ? ? ? A . n A 1 141 LEU 141 141 ? ? ? A . n A 1 142 THR 142 142 ? ? ? A . n A 1 143 ASP 143 143 ? ? ? A . n A 1 144 ASP 144 144 ? ? ? A . n A 1 145 GLU 145 145 ? ? ? A . n A 1 146 ASP 146 146 ? ? ? A . n A 1 147 GLY 147 147 ? ? ? A . n A 1 148 VAL 148 148 ? ? ? A . n A 1 149 PRO 149 149 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-12-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 28 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HD2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 29 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.56 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 30 ? ? OE2 A GLU 30 ? ? 1.362 1.252 0.110 0.011 N 2 1 CD A GLU 39 ? ? OE2 A GLU 39 ? ? 1.361 1.252 0.109 0.011 N 3 1 CD A GLU 44 ? ? OE2 A GLU 44 ? ? 1.373 1.252 0.121 0.011 N 4 1 CD A GLU 84 ? ? OE2 A GLU 84 ? ? 1.363 1.252 0.111 0.011 N 5 1 CD A GLU 100 ? ? OE2 A GLU 100 ? ? 1.363 1.252 0.111 0.011 N 6 1 CD A GLU 109 ? ? OE2 A GLU 109 ? ? 1.362 1.252 0.110 0.011 N 7 1 CD A GLU 130 ? ? OE2 A GLU 130 ? ? 1.360 1.252 0.108 0.011 N 8 1 CD A GLU 132 ? ? OE2 A GLU 132 ? ? 1.361 1.252 0.109 0.011 N 9 1 CD A GLU 135 ? ? OE2 A GLU 135 ? ? 1.360 1.252 0.108 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 23 ? ? CG A ASP 23 ? ? OD1 A ASP 23 ? ? 123.93 118.30 5.63 0.90 N 2 1 CB A ASP 23 ? ? CG A ASP 23 ? ? OD2 A ASP 23 ? ? 111.85 118.30 -6.45 0.90 N 3 1 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 124.44 120.30 4.14 0.50 N 4 1 CA A THR 43 ? ? CB A THR 43 ? ? OG1 A THR 43 ? ? 121.87 109.00 12.87 2.10 N 5 1 CD A ARG 51 ? ? NE A ARG 51 ? ? CZ A ARG 51 ? ? 132.65 123.60 9.05 1.40 N 6 1 NE A ARG 51 ? ? CZ A ARG 51 ? ? NH1 A ARG 51 ? ? 123.44 120.30 3.14 0.50 N 7 1 ND1 A HIS 55 ? ? CE1 A HIS 55 ? ? NE2 A HIS 55 ? ? 119.98 111.50 8.48 1.30 N 8 1 CB A TRP 59 ? ? CG A TRP 59 ? ? CD2 A TRP 59 ? ? 135.45 126.60 8.85 1.30 N 9 1 CD1 A TRP 59 ? ? NE1 A TRP 59 ? ? CE2 A TRP 59 ? ? 103.17 109.00 -5.83 0.90 N 10 1 CB A ASP 62 ? ? CG A ASP 62 ? ? OD1 A ASP 62 ? ? 123.78 118.30 5.48 0.90 N 11 1 CB A ASP 62 ? ? CG A ASP 62 ? ? OD2 A ASP 62 ? ? 112.39 118.30 -5.91 0.90 N 12 1 CB A ASP 67 ? ? CG A ASP 67 ? ? OD2 A ASP 67 ? ? 112.81 118.30 -5.49 0.90 N 13 1 CB A ASP 71 ? ? CG A ASP 71 ? ? OD1 A ASP 71 ? ? 123.92 118.30 5.62 0.90 N 14 1 CB A ASP 71 ? ? CG A ASP 71 ? ? OD2 A ASP 71 ? ? 112.33 118.30 -5.97 0.90 N 15 1 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH1 A ARG 72 ? ? 124.53 120.30 4.23 0.50 N 16 1 CB A ASP 74 ? ? CG A ASP 74 ? ? OD2 A ASP 74 ? ? 112.26 118.30 -6.04 0.90 N 17 1 CB A ASP 79 ? ? CG A ASP 79 ? ? OD2 A ASP 79 ? ? 112.69 118.30 -5.61 0.90 N 18 1 CA A GLU 84 ? ? C A GLU 84 ? ? N A VAL 85 ? ? 103.67 117.20 -13.53 2.20 Y 19 1 CB A ASP 90 ? ? CG A ASP 90 ? ? OD1 A ASP 90 ? ? 123.88 118.30 5.58 0.90 N 20 1 CB A ASP 90 ? ? CG A ASP 90 ? ? OD2 A ASP 90 ? ? 112.62 118.30 -5.68 0.90 N 21 1 NE A ARG 103 ? ? CZ A ARG 103 ? ? NH1 A ARG 103 ? ? 124.41 120.30 4.11 0.50 N 22 1 NE A ARG 103 ? ? CZ A ARG 103 ? ? NH2 A ARG 103 ? ? 117.28 120.30 -3.02 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 25 ? ? -159.72 -62.98 2 1 PRO A 26 ? ? -70.77 22.87 3 1 LYS A 27 ? ? -132.26 -72.46 4 1 ASP A 29 ? ? 87.00 27.69 5 1 GLU A 30 ? ? -90.07 31.51 6 1 GLU A 39 ? ? -42.69 -90.69 7 1 THR A 41 ? ? -145.29 -32.24 8 1 GLU A 44 ? ? 73.29 175.76 9 1 LYS A 73 ? ? 107.24 -48.11 10 1 LEU A 80 ? ? -46.01 106.49 11 1 LYS A 82 ? ? -124.84 -68.05 12 1 GLU A 84 ? ? 95.77 138.02 13 1 VAL A 85 ? ? -95.94 -122.27 14 1 GLU A 100 ? ? -95.60 -154.28 15 1 ALA A 111 ? ? -143.26 -120.00 16 1 LYS A 120 ? ? -152.01 -20.21 17 1 PRO A 123 ? ? -55.73 -0.02 18 1 PHE A 136 ? ? -147.36 -90.49 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 110 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.130 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 1 ? A GLU 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A MET 3 ? A MET 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A ILE 5 ? A ILE 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A ALA 7 ? A ALA 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A GLY 11 ? A GLY 11 12 1 Y 1 A ALA 12 ? A ALA 12 13 1 Y 1 A GLN 13 ? A GLN 13 14 1 Y 1 A SER 14 ? A SER 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A LEU 17 ? A LEU 17 18 1 Y 1 A PRO 18 ? A PRO 18 19 1 Y 1 A LEU 19 ? A LEU 19 20 1 Y 1 A GLU 20 ? A GLU 20 21 1 Y 1 A GLU 139 ? A GLU 139 22 1 Y 1 A ASP 140 ? A ASP 140 23 1 Y 1 A LEU 141 ? A LEU 141 24 1 Y 1 A THR 142 ? A THR 142 25 1 Y 1 A ASP 143 ? A ASP 143 26 1 Y 1 A ASP 144 ? A ASP 144 27 1 Y 1 A GLU 145 ? A GLU 145 28 1 Y 1 A ASP 146 ? A ASP 146 29 1 Y 1 A GLY 147 ? A GLY 147 30 1 Y 1 A VAL 148 ? A VAL 148 31 1 Y 1 A PRO 149 ? A PRO 149 #