data_1RRZ # _entry.id 1RRZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RRZ pdb_00001rrz 10.2210/pdb1rrz/pdb RCSB RCSB020999 ? ? WWPDB D_1000020999 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id GLGS_ECOLI _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RRZ _pdbx_database_status.recvd_initial_deposition_date 2003-12-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kozlov, G.' 1 'Gehring, K.' 2 'Montreal-Kingston Bacterial Structural Genomics Initiative (BSGI)' 3 # _citation.id primary _citation.title 'Structure of GlgS from Escherichia coli suggests a role in protein-protein interactions.' _citation.journal_abbrev 'BMC Biol.' _citation.journal_volume 2 _citation.page_first 10 _citation.page_last 10 _citation.year 2004 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1741-7007 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15161493 _citation.pdbx_database_id_DOI 10.1186/1741-7007-2-10 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kozlov, G.' 1 ? primary 'Elias, D.' 2 ? primary 'Cygler, M.' 3 ? primary 'Gehring, K.' 4 ? # _cell.entry_id 1RRZ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RRZ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Glycogen synthesis protein glgS' _entity.formula_weight 10073.255 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMDHSLNSLNNFDFLARSFARMHAEGRPVDILAVTGNMDEEHRTWFCARYAWYCQQMMQAR ELELEH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMDHSLNSLNNFDFLARSFARMHAEGRPVDILAVTGNMDEEHRTWFCARYAWYCQQMMQAR ELELEH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier GLGS_ECOLI # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ASP n 1 23 HIS n 1 24 SER n 1 25 LEU n 1 26 ASN n 1 27 SER n 1 28 LEU n 1 29 ASN n 1 30 ASN n 1 31 PHE n 1 32 ASP n 1 33 PHE n 1 34 LEU n 1 35 ALA n 1 36 ARG n 1 37 SER n 1 38 PHE n 1 39 ALA n 1 40 ARG n 1 41 MET n 1 42 HIS n 1 43 ALA n 1 44 GLU n 1 45 GLY n 1 46 ARG n 1 47 PRO n 1 48 VAL n 1 49 ASP n 1 50 ILE n 1 51 LEU n 1 52 ALA n 1 53 VAL n 1 54 THR n 1 55 GLY n 1 56 ASN n 1 57 MET n 1 58 ASP n 1 59 GLU n 1 60 GLU n 1 61 HIS n 1 62 ARG n 1 63 THR n 1 64 TRP n 1 65 PHE n 1 66 CYS n 1 67 ALA n 1 68 ARG n 1 69 TYR n 1 70 ALA n 1 71 TRP n 1 72 TYR n 1 73 CYS n 1 74 GLN n 1 75 GLN n 1 76 MET n 1 77 MET n 1 78 GLN n 1 79 ALA n 1 80 ARG n 1 81 GLU n 1 82 LEU n 1 83 GLU n 1 84 LEU n 1 85 GLU n 1 86 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene 'GLGS, B3049' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLGS_ECOLI _struct_ref.pdbx_db_accession P26649 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MDHSLNSLNNFDFLARSFARMHAEGRPVDILAVTGNMDEEHRTWFCARYAWYCQQMMQARELELEH _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RRZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P26649 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 66 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1RRZ MET A 1 ? UNP P26649 ? ? 'expression tag' -19 1 1 1RRZ GLY A 2 ? UNP P26649 ? ? 'expression tag' -18 2 1 1RRZ SER A 3 ? UNP P26649 ? ? 'expression tag' -17 3 1 1RRZ SER A 4 ? UNP P26649 ? ? 'expression tag' -16 4 1 1RRZ HIS A 5 ? UNP P26649 ? ? 'expression tag' -15 5 1 1RRZ HIS A 6 ? UNP P26649 ? ? 'expression tag' -14 6 1 1RRZ HIS A 7 ? UNP P26649 ? ? 'expression tag' -13 7 1 1RRZ HIS A 8 ? UNP P26649 ? ? 'expression tag' -12 8 1 1RRZ HIS A 9 ? UNP P26649 ? ? 'expression tag' -11 9 1 1RRZ HIS A 10 ? UNP P26649 ? ? 'expression tag' -10 10 1 1RRZ SER A 11 ? UNP P26649 ? ? 'expression tag' -9 11 1 1RRZ SER A 12 ? UNP P26649 ? ? 'expression tag' -8 12 1 1RRZ GLY A 13 ? UNP P26649 ? ? 'expression tag' -7 13 1 1RRZ LEU A 14 ? UNP P26649 ? ? 'expression tag' -6 14 1 1RRZ VAL A 15 ? UNP P26649 ? ? 'expression tag' -5 15 1 1RRZ PRO A 16 ? UNP P26649 ? ? 'expression tag' -4 16 1 1RRZ ARG A 17 ? UNP P26649 ? ? 'expression tag' -3 17 1 1RRZ GLY A 18 ? UNP P26649 ? ? 'expression tag' -2 18 1 1RRZ SER A 19 ? UNP P26649 ? ? 'expression tag' -1 19 1 1RRZ HIS A 20 ? UNP P26649 ? ? 'expression tag' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 1 '2D NOESY' 3 3 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength '5mM potassium phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM GlgS U-15N; 5mM potassium phosphate; 1mM DTT; 0.1mM sodium azide' '90% H2O/10% D2O' 2 '1mM GlgS; 5mM potassium phosphate; 1mM DTT; 0.1mM sodium azide' '90% H2O/10% D2O' 3 '1mM GlgS; 5mM potassium phosphate; 1mM DTT; 0.1mM sodium azide' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1RRZ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 449 restraints, 311 are NOE-derived distance constraints, 109 TALOS-derived dihedral angle restraints, 29 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1RRZ _pdbx_nmr_details.text 'This structure was determined using standard triple-resonance and homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1RRZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RRZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.1 collection 'Bruker Biospin' 1 XwinNMR 2.1 processing 'Bruker Biospin' 2 XEASY 1.3.13 'data analysis' Wuthrich 3 CYANA 1.0.6 'structure solution' Guentert 4 Xplor-NIH 2.9.2 refinement Clore 5 # _exptl.entry_id 1RRZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1RRZ _struct.title 'Solution structure of GlgS protein from E. coli' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RRZ _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS,BIOSYNTHETIC PROTEIN' _struct_keywords.text 'all-helical domain, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, BIOSYNTHETIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 26 ? GLY A 45 ? ASN A 6 GLY A 25 1 ? 20 HELX_P HELX_P2 2 ASP A 49 ? MET A 57 ? ASP A 29 MET A 37 1 ? 9 HELX_P HELX_P3 3 GLU A 60 ? ARG A 80 ? GLU A 40 ARG A 60 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1RRZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RRZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 ASP 22 2 2 ASP ASP A . n A 1 23 HIS 23 3 3 HIS HIS A . n A 1 24 SER 24 4 4 SER SER A . n A 1 25 LEU 25 5 5 LEU LEU A . n A 1 26 ASN 26 6 6 ASN ASN A . n A 1 27 SER 27 7 7 SER SER A . n A 1 28 LEU 28 8 8 LEU LEU A . n A 1 29 ASN 29 9 9 ASN ASN A . n A 1 30 ASN 30 10 10 ASN ASN A . n A 1 31 PHE 31 11 11 PHE PHE A . n A 1 32 ASP 32 12 12 ASP ASP A . n A 1 33 PHE 33 13 13 PHE PHE A . n A 1 34 LEU 34 14 14 LEU LEU A . n A 1 35 ALA 35 15 15 ALA ALA A . n A 1 36 ARG 36 16 16 ARG ARG A . n A 1 37 SER 37 17 17 SER SER A . n A 1 38 PHE 38 18 18 PHE PHE A . n A 1 39 ALA 39 19 19 ALA ALA A . n A 1 40 ARG 40 20 20 ARG ARG A . n A 1 41 MET 41 21 21 MET MET A . n A 1 42 HIS 42 22 22 HIS HIS A . n A 1 43 ALA 43 23 23 ALA ALA A . n A 1 44 GLU 44 24 24 GLU GLU A . n A 1 45 GLY 45 25 25 GLY GLY A . n A 1 46 ARG 46 26 26 ARG ARG A . n A 1 47 PRO 47 27 27 PRO PRO A . n A 1 48 VAL 48 28 28 VAL VAL A . n A 1 49 ASP 49 29 29 ASP ASP A . n A 1 50 ILE 50 30 30 ILE ILE A . n A 1 51 LEU 51 31 31 LEU LEU A . n A 1 52 ALA 52 32 32 ALA ALA A . n A 1 53 VAL 53 33 33 VAL VAL A . n A 1 54 THR 54 34 34 THR THR A . n A 1 55 GLY 55 35 35 GLY GLY A . n A 1 56 ASN 56 36 36 ASN ASN A . n A 1 57 MET 57 37 37 MET MET A . n A 1 58 ASP 58 38 38 ASP ASP A . n A 1 59 GLU 59 39 39 GLU GLU A . n A 1 60 GLU 60 40 40 GLU GLU A . n A 1 61 HIS 61 41 41 HIS HIS A . n A 1 62 ARG 62 42 42 ARG ARG A . n A 1 63 THR 63 43 43 THR THR A . n A 1 64 TRP 64 44 44 TRP TRP A . n A 1 65 PHE 65 45 45 PHE PHE A . n A 1 66 CYS 66 46 46 CYS CYS A . n A 1 67 ALA 67 47 47 ALA ALA A . n A 1 68 ARG 68 48 48 ARG ARG A . n A 1 69 TYR 69 49 49 TYR TYR A . n A 1 70 ALA 70 50 50 ALA ALA A . n A 1 71 TRP 71 51 51 TRP TRP A . n A 1 72 TYR 72 52 52 TYR TYR A . n A 1 73 CYS 73 53 53 CYS CYS A . n A 1 74 GLN 74 54 54 GLN GLN A . n A 1 75 GLN 75 55 55 GLN GLN A . n A 1 76 MET 76 56 56 MET MET A . n A 1 77 MET 77 57 57 MET MET A . n A 1 78 GLN 78 58 58 GLN GLN A . n A 1 79 ALA 79 59 59 ALA ALA A . n A 1 80 ARG 80 60 60 ARG ARG A . n A 1 81 GLU 81 61 61 GLU GLU A . n A 1 82 LEU 82 62 62 LEU LEU A . n A 1 83 GLU 83 63 63 GLU GLU A . n A 1 84 LEU 84 64 64 LEU LEU A . n A 1 85 GLU 85 65 65 GLU GLU A . n A 1 86 HIS 86 66 66 HIS HIS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Montreal-Kingston Bacterial Structural Genomics Initiative' _pdbx_SG_project.initial_of_center BSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-06-01 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 14 ? ? H A PHE 18 ? ? 1.58 2 2 O A LEU 14 ? ? H A PHE 18 ? ? 1.49 3 3 O A LEU 14 ? ? H A PHE 18 ? ? 1.50 4 4 O A LEU 14 ? ? H A PHE 18 ? ? 1.50 5 5 O A LEU 14 ? ? H A PHE 18 ? ? 1.48 6 6 O A LEU 14 ? ? H A PHE 18 ? ? 1.56 7 7 O A LEU 14 ? ? H A PHE 18 ? ? 1.51 8 8 O A LEU 14 ? ? H A PHE 18 ? ? 1.53 9 10 O A LEU 14 ? ? H A PHE 18 ? ? 1.59 10 11 O A LEU 14 ? ? H A PHE 18 ? ? 1.55 11 12 O A LEU 14 ? ? H A PHE 18 ? ? 1.53 12 13 O A LEU 14 ? ? H A PHE 18 ? ? 1.49 13 14 O A LEU 14 ? ? H A PHE 18 ? ? 1.57 14 15 O A LEU 14 ? ? H A PHE 18 ? ? 1.49 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 37 ? ? 64.62 106.96 2 1 GLU A 61 ? ? -159.81 -59.25 3 1 GLU A 65 ? ? -132.80 -64.11 4 2 ASP A 29 ? ? -68.69 87.16 5 2 ASP A 38 ? ? -145.33 -54.53 6 2 GLU A 61 ? ? -76.36 -77.85 7 2 GLU A 63 ? ? 57.53 72.34 8 3 ASP A 29 ? ? -69.62 86.74 9 3 MET A 37 ? ? 61.59 97.48 10 3 ARG A 60 ? ? 73.20 -46.01 11 3 GLU A 61 ? ? -153.84 -80.87 12 3 LEU A 62 ? ? 60.29 -74.91 13 4 ASP A 38 ? ? -139.13 -44.83 14 4 LEU A 62 ? ? -126.08 -52.72 15 5 ASP A 2 ? ? -119.57 65.74 16 5 HIS A 3 ? ? -115.95 -167.35 17 5 ASP A 38 ? ? -138.74 -43.17 18 5 ARG A 60 ? ? -65.06 -70.94 19 5 GLU A 61 ? ? 59.58 -84.65 20 5 GLU A 65 ? ? -126.71 -57.43 21 6 ASP A 2 ? ? 57.62 -173.82 22 6 HIS A 3 ? ? 62.06 177.06 23 6 GLU A 61 ? ? -142.25 -55.46 24 6 GLU A 65 ? ? -128.25 -51.21 25 7 ASP A 38 ? ? -143.95 -54.46 26 7 GLU A 61 ? ? -123.70 -50.45 27 7 GLU A 63 ? ? 59.48 177.10 28 7 GLU A 65 ? ? -145.20 -75.38 29 8 ASP A 38 ? ? -145.46 -51.12 30 8 GLU A 63 ? ? 57.76 -165.97 31 9 GLU A 61 ? ? -157.43 -57.63 32 9 GLU A 65 ? ? -150.85 -50.30 33 10 ASP A 2 ? ? -143.94 41.64 34 10 ASP A 29 ? ? -69.09 86.20 35 10 ASN A 36 ? ? -163.89 54.88 36 10 MET A 37 ? ? -162.18 49.84 37 10 ARG A 60 ? ? 58.46 147.34 38 11 ASP A 2 ? ? 56.95 84.84 39 11 HIS A 3 ? ? -68.37 -178.42 40 11 MET A 37 ? ? 59.37 91.44 41 11 ARG A 60 ? ? 43.79 71.57 42 11 LEU A 62 ? ? 66.04 151.02 43 11 GLU A 65 ? ? 63.69 98.86 44 12 HIS A 3 ? ? 70.07 150.95 45 12 ASP A 38 ? ? -150.33 -52.36 46 12 LEU A 62 ? ? 68.62 -69.12 47 13 ASP A 29 ? ? -68.57 86.13 48 13 ASP A 38 ? ? -140.60 -42.62 49 13 ARG A 60 ? ? -68.55 89.27 50 13 GLU A 61 ? ? -171.79 -50.48 51 13 LEU A 62 ? ? -124.54 -54.69 52 13 GLU A 65 ? ? 60.85 -159.08 53 14 ASP A 2 ? ? 60.25 -165.33 54 14 MET A 37 ? ? -159.23 68.78 55 14 ARG A 60 ? ? 55.60 103.66 56 15 ASP A 2 ? ? -133.46 -57.27 57 15 ASP A 38 ? ? -150.07 -55.11 58 15 ARG A 60 ? ? 39.35 51.43 59 15 LEU A 62 ? ? 59.95 -82.27 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 16 ? ? 0.319 'SIDE CHAIN' 2 1 ARG A 20 ? ? 0.316 'SIDE CHAIN' 3 1 ARG A 26 ? ? 0.318 'SIDE CHAIN' 4 1 ARG A 42 ? ? 0.319 'SIDE CHAIN' 5 1 ARG A 48 ? ? 0.169 'SIDE CHAIN' 6 1 ARG A 60 ? ? 0.315 'SIDE CHAIN' 7 2 ARG A 16 ? ? 0.318 'SIDE CHAIN' 8 2 ARG A 20 ? ? 0.242 'SIDE CHAIN' 9 2 ARG A 26 ? ? 0.318 'SIDE CHAIN' 10 2 ARG A 42 ? ? 0.319 'SIDE CHAIN' 11 2 ARG A 48 ? ? 0.315 'SIDE CHAIN' 12 2 ARG A 60 ? ? 0.301 'SIDE CHAIN' 13 3 ARG A 16 ? ? 0.318 'SIDE CHAIN' 14 3 ARG A 20 ? ? 0.317 'SIDE CHAIN' 15 3 ARG A 26 ? ? 0.318 'SIDE CHAIN' 16 3 ARG A 42 ? ? 0.315 'SIDE CHAIN' 17 3 ARG A 48 ? ? 0.315 'SIDE CHAIN' 18 3 ARG A 60 ? ? 0.319 'SIDE CHAIN' 19 4 ARG A 16 ? ? 0.317 'SIDE CHAIN' 20 4 ARG A 20 ? ? 0.310 'SIDE CHAIN' 21 4 ARG A 26 ? ? 0.311 'SIDE CHAIN' 22 4 ARG A 42 ? ? 0.313 'SIDE CHAIN' 23 4 ARG A 48 ? ? 0.316 'SIDE CHAIN' 24 4 ARG A 60 ? ? 0.319 'SIDE CHAIN' 25 5 ARG A 16 ? ? 0.317 'SIDE CHAIN' 26 5 ARG A 20 ? ? 0.316 'SIDE CHAIN' 27 5 ARG A 26 ? ? 0.299 'SIDE CHAIN' 28 5 ARG A 42 ? ? 0.316 'SIDE CHAIN' 29 5 ARG A 48 ? ? 0.301 'SIDE CHAIN' 30 5 ARG A 60 ? ? 0.316 'SIDE CHAIN' 31 6 ARG A 16 ? ? 0.318 'SIDE CHAIN' 32 6 ARG A 20 ? ? 0.313 'SIDE CHAIN' 33 6 ARG A 26 ? ? 0.317 'SIDE CHAIN' 34 6 ARG A 42 ? ? 0.317 'SIDE CHAIN' 35 6 ARG A 48 ? ? 0.300 'SIDE CHAIN' 36 6 ARG A 60 ? ? 0.317 'SIDE CHAIN' 37 7 ARG A 16 ? ? 0.318 'SIDE CHAIN' 38 7 ARG A 20 ? ? 0.317 'SIDE CHAIN' 39 7 ARG A 26 ? ? 0.315 'SIDE CHAIN' 40 7 ARG A 42 ? ? 0.316 'SIDE CHAIN' 41 7 ARG A 48 ? ? 0.238 'SIDE CHAIN' 42 7 ARG A 60 ? ? 0.316 'SIDE CHAIN' 43 8 ARG A 16 ? ? 0.317 'SIDE CHAIN' 44 8 ARG A 20 ? ? 0.317 'SIDE CHAIN' 45 8 ARG A 26 ? ? 0.308 'SIDE CHAIN' 46 8 ARG A 42 ? ? 0.302 'SIDE CHAIN' 47 8 ARG A 48 ? ? 0.199 'SIDE CHAIN' 48 8 ARG A 60 ? ? 0.309 'SIDE CHAIN' 49 9 ARG A 16 ? ? 0.317 'SIDE CHAIN' 50 9 ARG A 20 ? ? 0.313 'SIDE CHAIN' 51 9 ARG A 26 ? ? 0.317 'SIDE CHAIN' 52 9 ARG A 42 ? ? 0.309 'SIDE CHAIN' 53 9 ARG A 48 ? ? 0.301 'SIDE CHAIN' 54 9 ARG A 60 ? ? 0.300 'SIDE CHAIN' 55 10 ARG A 16 ? ? 0.317 'SIDE CHAIN' 56 10 ARG A 20 ? ? 0.308 'SIDE CHAIN' 57 10 ARG A 26 ? ? 0.316 'SIDE CHAIN' 58 10 ARG A 42 ? ? 0.316 'SIDE CHAIN' 59 10 ARG A 48 ? ? 0.303 'SIDE CHAIN' 60 10 ARG A 60 ? ? 0.316 'SIDE CHAIN' 61 11 ARG A 16 ? ? 0.315 'SIDE CHAIN' 62 11 ARG A 20 ? ? 0.309 'SIDE CHAIN' 63 11 ARG A 26 ? ? 0.298 'SIDE CHAIN' 64 11 ARG A 42 ? ? 0.315 'SIDE CHAIN' 65 11 ARG A 48 ? ? 0.313 'SIDE CHAIN' 66 11 ARG A 60 ? ? 0.294 'SIDE CHAIN' 67 12 ARG A 16 ? ? 0.318 'SIDE CHAIN' 68 12 ARG A 20 ? ? 0.309 'SIDE CHAIN' 69 12 ARG A 26 ? ? 0.317 'SIDE CHAIN' 70 12 ARG A 42 ? ? 0.316 'SIDE CHAIN' 71 12 ARG A 48 ? ? 0.306 'SIDE CHAIN' 72 12 ARG A 60 ? ? 0.317 'SIDE CHAIN' 73 13 ARG A 16 ? ? 0.315 'SIDE CHAIN' 74 13 ARG A 20 ? ? 0.318 'SIDE CHAIN' 75 13 ARG A 26 ? ? 0.310 'SIDE CHAIN' 76 13 ARG A 42 ? ? 0.309 'SIDE CHAIN' 77 13 ARG A 48 ? ? 0.313 'SIDE CHAIN' 78 13 ARG A 60 ? ? 0.312 'SIDE CHAIN' 79 14 ARG A 16 ? ? 0.311 'SIDE CHAIN' 80 14 ARG A 20 ? ? 0.317 'SIDE CHAIN' 81 14 ARG A 26 ? ? 0.316 'SIDE CHAIN' 82 14 ARG A 42 ? ? 0.315 'SIDE CHAIN' 83 14 ARG A 48 ? ? 0.312 'SIDE CHAIN' 84 14 ARG A 60 ? ? 0.317 'SIDE CHAIN' 85 15 ARG A 16 ? ? 0.317 'SIDE CHAIN' 86 15 ARG A 20 ? ? 0.316 'SIDE CHAIN' 87 15 ARG A 26 ? ? 0.308 'SIDE CHAIN' 88 15 ARG A 42 ? ? 0.313 'SIDE CHAIN' 89 15 ARG A 48 ? ? 0.316 'SIDE CHAIN' 90 15 ARG A 60 ? ? 0.298 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 2 Y 1 A MET -19 ? A MET 1 22 2 Y 1 A GLY -18 ? A GLY 2 23 2 Y 1 A SER -17 ? A SER 3 24 2 Y 1 A SER -16 ? A SER 4 25 2 Y 1 A HIS -15 ? A HIS 5 26 2 Y 1 A HIS -14 ? A HIS 6 27 2 Y 1 A HIS -13 ? A HIS 7 28 2 Y 1 A HIS -12 ? A HIS 8 29 2 Y 1 A HIS -11 ? A HIS 9 30 2 Y 1 A HIS -10 ? A HIS 10 31 2 Y 1 A SER -9 ? A SER 11 32 2 Y 1 A SER -8 ? A SER 12 33 2 Y 1 A GLY -7 ? A GLY 13 34 2 Y 1 A LEU -6 ? A LEU 14 35 2 Y 1 A VAL -5 ? A VAL 15 36 2 Y 1 A PRO -4 ? A PRO 16 37 2 Y 1 A ARG -3 ? A ARG 17 38 2 Y 1 A GLY -2 ? A GLY 18 39 2 Y 1 A SER -1 ? A SER 19 40 2 Y 1 A HIS 0 ? A HIS 20 41 3 Y 1 A MET -19 ? A MET 1 42 3 Y 1 A GLY -18 ? A GLY 2 43 3 Y 1 A SER -17 ? A SER 3 44 3 Y 1 A SER -16 ? A SER 4 45 3 Y 1 A HIS -15 ? A HIS 5 46 3 Y 1 A HIS -14 ? A HIS 6 47 3 Y 1 A HIS -13 ? A HIS 7 48 3 Y 1 A HIS -12 ? A HIS 8 49 3 Y 1 A HIS -11 ? A HIS 9 50 3 Y 1 A HIS -10 ? A HIS 10 51 3 Y 1 A SER -9 ? A SER 11 52 3 Y 1 A SER -8 ? A SER 12 53 3 Y 1 A GLY -7 ? A GLY 13 54 3 Y 1 A LEU -6 ? A LEU 14 55 3 Y 1 A VAL -5 ? A VAL 15 56 3 Y 1 A PRO -4 ? A PRO 16 57 3 Y 1 A ARG -3 ? A ARG 17 58 3 Y 1 A GLY -2 ? A GLY 18 59 3 Y 1 A SER -1 ? A SER 19 60 3 Y 1 A HIS 0 ? A HIS 20 61 4 Y 1 A MET -19 ? A MET 1 62 4 Y 1 A GLY -18 ? A GLY 2 63 4 Y 1 A SER -17 ? A SER 3 64 4 Y 1 A SER -16 ? A SER 4 65 4 Y 1 A HIS -15 ? A HIS 5 66 4 Y 1 A HIS -14 ? A HIS 6 67 4 Y 1 A HIS -13 ? A HIS 7 68 4 Y 1 A HIS -12 ? A HIS 8 69 4 Y 1 A HIS -11 ? A HIS 9 70 4 Y 1 A HIS -10 ? A HIS 10 71 4 Y 1 A SER -9 ? A SER 11 72 4 Y 1 A SER -8 ? A SER 12 73 4 Y 1 A GLY -7 ? A GLY 13 74 4 Y 1 A LEU -6 ? A LEU 14 75 4 Y 1 A VAL -5 ? A VAL 15 76 4 Y 1 A PRO -4 ? A PRO 16 77 4 Y 1 A ARG -3 ? A ARG 17 78 4 Y 1 A GLY -2 ? A GLY 18 79 4 Y 1 A SER -1 ? A SER 19 80 4 Y 1 A HIS 0 ? A HIS 20 81 5 Y 1 A MET -19 ? A MET 1 82 5 Y 1 A GLY -18 ? A GLY 2 83 5 Y 1 A SER -17 ? A SER 3 84 5 Y 1 A SER -16 ? A SER 4 85 5 Y 1 A HIS -15 ? A HIS 5 86 5 Y 1 A HIS -14 ? A HIS 6 87 5 Y 1 A HIS -13 ? A HIS 7 88 5 Y 1 A HIS -12 ? A HIS 8 89 5 Y 1 A HIS -11 ? A HIS 9 90 5 Y 1 A HIS -10 ? A HIS 10 91 5 Y 1 A SER -9 ? A SER 11 92 5 Y 1 A SER -8 ? A SER 12 93 5 Y 1 A GLY -7 ? A GLY 13 94 5 Y 1 A LEU -6 ? A LEU 14 95 5 Y 1 A VAL -5 ? A VAL 15 96 5 Y 1 A PRO -4 ? A PRO 16 97 5 Y 1 A ARG -3 ? A ARG 17 98 5 Y 1 A GLY -2 ? A GLY 18 99 5 Y 1 A SER -1 ? A SER 19 100 5 Y 1 A HIS 0 ? A HIS 20 101 6 Y 1 A MET -19 ? A MET 1 102 6 Y 1 A GLY -18 ? A GLY 2 103 6 Y 1 A SER -17 ? A SER 3 104 6 Y 1 A SER -16 ? A SER 4 105 6 Y 1 A HIS -15 ? A HIS 5 106 6 Y 1 A HIS -14 ? A HIS 6 107 6 Y 1 A HIS -13 ? A HIS 7 108 6 Y 1 A HIS -12 ? A HIS 8 109 6 Y 1 A HIS -11 ? A HIS 9 110 6 Y 1 A HIS -10 ? A HIS 10 111 6 Y 1 A SER -9 ? A SER 11 112 6 Y 1 A SER -8 ? A SER 12 113 6 Y 1 A GLY -7 ? A GLY 13 114 6 Y 1 A LEU -6 ? A LEU 14 115 6 Y 1 A VAL -5 ? A VAL 15 116 6 Y 1 A PRO -4 ? A PRO 16 117 6 Y 1 A ARG -3 ? A ARG 17 118 6 Y 1 A GLY -2 ? A GLY 18 119 6 Y 1 A SER -1 ? A SER 19 120 6 Y 1 A HIS 0 ? A HIS 20 121 7 Y 1 A MET -19 ? A MET 1 122 7 Y 1 A GLY -18 ? A GLY 2 123 7 Y 1 A SER -17 ? A SER 3 124 7 Y 1 A SER -16 ? A SER 4 125 7 Y 1 A HIS -15 ? A HIS 5 126 7 Y 1 A HIS -14 ? A HIS 6 127 7 Y 1 A HIS -13 ? A HIS 7 128 7 Y 1 A HIS -12 ? A HIS 8 129 7 Y 1 A HIS -11 ? A HIS 9 130 7 Y 1 A HIS -10 ? A HIS 10 131 7 Y 1 A SER -9 ? A SER 11 132 7 Y 1 A SER -8 ? A SER 12 133 7 Y 1 A GLY -7 ? A GLY 13 134 7 Y 1 A LEU -6 ? A LEU 14 135 7 Y 1 A VAL -5 ? A VAL 15 136 7 Y 1 A PRO -4 ? A PRO 16 137 7 Y 1 A ARG -3 ? A ARG 17 138 7 Y 1 A GLY -2 ? A GLY 18 139 7 Y 1 A SER -1 ? A SER 19 140 7 Y 1 A HIS 0 ? A HIS 20 141 8 Y 1 A MET -19 ? A MET 1 142 8 Y 1 A GLY -18 ? A GLY 2 143 8 Y 1 A SER -17 ? A SER 3 144 8 Y 1 A SER -16 ? A SER 4 145 8 Y 1 A HIS -15 ? A HIS 5 146 8 Y 1 A HIS -14 ? A HIS 6 147 8 Y 1 A HIS -13 ? A HIS 7 148 8 Y 1 A HIS -12 ? A HIS 8 149 8 Y 1 A HIS -11 ? A HIS 9 150 8 Y 1 A HIS -10 ? A HIS 10 151 8 Y 1 A SER -9 ? A SER 11 152 8 Y 1 A SER -8 ? A SER 12 153 8 Y 1 A GLY -7 ? A GLY 13 154 8 Y 1 A LEU -6 ? A LEU 14 155 8 Y 1 A VAL -5 ? A VAL 15 156 8 Y 1 A PRO -4 ? A PRO 16 157 8 Y 1 A ARG -3 ? A ARG 17 158 8 Y 1 A GLY -2 ? A GLY 18 159 8 Y 1 A SER -1 ? A SER 19 160 8 Y 1 A HIS 0 ? A HIS 20 161 9 Y 1 A MET -19 ? A MET 1 162 9 Y 1 A GLY -18 ? A GLY 2 163 9 Y 1 A SER -17 ? A SER 3 164 9 Y 1 A SER -16 ? A SER 4 165 9 Y 1 A HIS -15 ? A HIS 5 166 9 Y 1 A HIS -14 ? A HIS 6 167 9 Y 1 A HIS -13 ? A HIS 7 168 9 Y 1 A HIS -12 ? A HIS 8 169 9 Y 1 A HIS -11 ? A HIS 9 170 9 Y 1 A HIS -10 ? A HIS 10 171 9 Y 1 A SER -9 ? A SER 11 172 9 Y 1 A SER -8 ? A SER 12 173 9 Y 1 A GLY -7 ? A GLY 13 174 9 Y 1 A LEU -6 ? A LEU 14 175 9 Y 1 A VAL -5 ? A VAL 15 176 9 Y 1 A PRO -4 ? A PRO 16 177 9 Y 1 A ARG -3 ? A ARG 17 178 9 Y 1 A GLY -2 ? A GLY 18 179 9 Y 1 A SER -1 ? A SER 19 180 9 Y 1 A HIS 0 ? A HIS 20 181 10 Y 1 A MET -19 ? A MET 1 182 10 Y 1 A GLY -18 ? A GLY 2 183 10 Y 1 A SER -17 ? A SER 3 184 10 Y 1 A SER -16 ? A SER 4 185 10 Y 1 A HIS -15 ? A HIS 5 186 10 Y 1 A HIS -14 ? A HIS 6 187 10 Y 1 A HIS -13 ? A HIS 7 188 10 Y 1 A HIS -12 ? A HIS 8 189 10 Y 1 A HIS -11 ? A HIS 9 190 10 Y 1 A HIS -10 ? A HIS 10 191 10 Y 1 A SER -9 ? A SER 11 192 10 Y 1 A SER -8 ? A SER 12 193 10 Y 1 A GLY -7 ? A GLY 13 194 10 Y 1 A LEU -6 ? A LEU 14 195 10 Y 1 A VAL -5 ? A VAL 15 196 10 Y 1 A PRO -4 ? A PRO 16 197 10 Y 1 A ARG -3 ? A ARG 17 198 10 Y 1 A GLY -2 ? A GLY 18 199 10 Y 1 A SER -1 ? A SER 19 200 10 Y 1 A HIS 0 ? A HIS 20 201 11 Y 1 A MET -19 ? A MET 1 202 11 Y 1 A GLY -18 ? A GLY 2 203 11 Y 1 A SER -17 ? A SER 3 204 11 Y 1 A SER -16 ? A SER 4 205 11 Y 1 A HIS -15 ? A HIS 5 206 11 Y 1 A HIS -14 ? A HIS 6 207 11 Y 1 A HIS -13 ? A HIS 7 208 11 Y 1 A HIS -12 ? A HIS 8 209 11 Y 1 A HIS -11 ? A HIS 9 210 11 Y 1 A HIS -10 ? A HIS 10 211 11 Y 1 A SER -9 ? A SER 11 212 11 Y 1 A SER -8 ? A SER 12 213 11 Y 1 A GLY -7 ? A GLY 13 214 11 Y 1 A LEU -6 ? A LEU 14 215 11 Y 1 A VAL -5 ? A VAL 15 216 11 Y 1 A PRO -4 ? A PRO 16 217 11 Y 1 A ARG -3 ? A ARG 17 218 11 Y 1 A GLY -2 ? A GLY 18 219 11 Y 1 A SER -1 ? A SER 19 220 11 Y 1 A HIS 0 ? A HIS 20 221 12 Y 1 A MET -19 ? A MET 1 222 12 Y 1 A GLY -18 ? A GLY 2 223 12 Y 1 A SER -17 ? A SER 3 224 12 Y 1 A SER -16 ? A SER 4 225 12 Y 1 A HIS -15 ? A HIS 5 226 12 Y 1 A HIS -14 ? A HIS 6 227 12 Y 1 A HIS -13 ? A HIS 7 228 12 Y 1 A HIS -12 ? A HIS 8 229 12 Y 1 A HIS -11 ? A HIS 9 230 12 Y 1 A HIS -10 ? A HIS 10 231 12 Y 1 A SER -9 ? A SER 11 232 12 Y 1 A SER -8 ? A SER 12 233 12 Y 1 A GLY -7 ? A GLY 13 234 12 Y 1 A LEU -6 ? A LEU 14 235 12 Y 1 A VAL -5 ? A VAL 15 236 12 Y 1 A PRO -4 ? A PRO 16 237 12 Y 1 A ARG -3 ? A ARG 17 238 12 Y 1 A GLY -2 ? A GLY 18 239 12 Y 1 A SER -1 ? A SER 19 240 12 Y 1 A HIS 0 ? A HIS 20 241 13 Y 1 A MET -19 ? A MET 1 242 13 Y 1 A GLY -18 ? A GLY 2 243 13 Y 1 A SER -17 ? A SER 3 244 13 Y 1 A SER -16 ? A SER 4 245 13 Y 1 A HIS -15 ? A HIS 5 246 13 Y 1 A HIS -14 ? A HIS 6 247 13 Y 1 A HIS -13 ? A HIS 7 248 13 Y 1 A HIS -12 ? A HIS 8 249 13 Y 1 A HIS -11 ? A HIS 9 250 13 Y 1 A HIS -10 ? A HIS 10 251 13 Y 1 A SER -9 ? A SER 11 252 13 Y 1 A SER -8 ? A SER 12 253 13 Y 1 A GLY -7 ? A GLY 13 254 13 Y 1 A LEU -6 ? A LEU 14 255 13 Y 1 A VAL -5 ? A VAL 15 256 13 Y 1 A PRO -4 ? A PRO 16 257 13 Y 1 A ARG -3 ? A ARG 17 258 13 Y 1 A GLY -2 ? A GLY 18 259 13 Y 1 A SER -1 ? A SER 19 260 13 Y 1 A HIS 0 ? A HIS 20 261 14 Y 1 A MET -19 ? A MET 1 262 14 Y 1 A GLY -18 ? A GLY 2 263 14 Y 1 A SER -17 ? A SER 3 264 14 Y 1 A SER -16 ? A SER 4 265 14 Y 1 A HIS -15 ? A HIS 5 266 14 Y 1 A HIS -14 ? A HIS 6 267 14 Y 1 A HIS -13 ? A HIS 7 268 14 Y 1 A HIS -12 ? A HIS 8 269 14 Y 1 A HIS -11 ? A HIS 9 270 14 Y 1 A HIS -10 ? A HIS 10 271 14 Y 1 A SER -9 ? A SER 11 272 14 Y 1 A SER -8 ? A SER 12 273 14 Y 1 A GLY -7 ? A GLY 13 274 14 Y 1 A LEU -6 ? A LEU 14 275 14 Y 1 A VAL -5 ? A VAL 15 276 14 Y 1 A PRO -4 ? A PRO 16 277 14 Y 1 A ARG -3 ? A ARG 17 278 14 Y 1 A GLY -2 ? A GLY 18 279 14 Y 1 A SER -1 ? A SER 19 280 14 Y 1 A HIS 0 ? A HIS 20 281 15 Y 1 A MET -19 ? A MET 1 282 15 Y 1 A GLY -18 ? A GLY 2 283 15 Y 1 A SER -17 ? A SER 3 284 15 Y 1 A SER -16 ? A SER 4 285 15 Y 1 A HIS -15 ? A HIS 5 286 15 Y 1 A HIS -14 ? A HIS 6 287 15 Y 1 A HIS -13 ? A HIS 7 288 15 Y 1 A HIS -12 ? A HIS 8 289 15 Y 1 A HIS -11 ? A HIS 9 290 15 Y 1 A HIS -10 ? A HIS 10 291 15 Y 1 A SER -9 ? A SER 11 292 15 Y 1 A SER -8 ? A SER 12 293 15 Y 1 A GLY -7 ? A GLY 13 294 15 Y 1 A LEU -6 ? A LEU 14 295 15 Y 1 A VAL -5 ? A VAL 15 296 15 Y 1 A PRO -4 ? A PRO 16 297 15 Y 1 A ARG -3 ? A ARG 17 298 15 Y 1 A GLY -2 ? A GLY 18 299 15 Y 1 A SER -1 ? A SER 19 300 15 Y 1 A HIS 0 ? A HIS 20 #