data_1RSZ # _entry.id 1RSZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.303 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1RSZ RCSB RCSB021020 WWPDB D_1000021020 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1RR6 'Same protein in complex with Immucillin-H and phosphate' unspecified PDB 1RT9 'Same protein in complex with Immucillin-H and sulfate' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RSZ _pdbx_database_status.recvd_initial_deposition_date 2003-12-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shi, W.' 1 'Lewandowicz, A.' 2 'Tyler, P.C.' 3 'Furneaux, R.H.' 4 'Almo, S.C.' 5 'Schramm, V.L.' 6 # _citation.id primary _citation.title 'Structural comparison of human and malarial purine nucleoside phosphorylases' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shi, W.' 1 ? primary 'Lewandowicz, A.' 2 ? primary 'Tyler, P.C.' 3 ? primary 'Furneaux, R.H.' 4 ? primary 'Almo, S.C.' 5 ? primary 'Schramm, V.L.' 6 ? # _cell.entry_id 1RSZ _cell.length_a 142.162 _cell.length_b 142.162 _cell.length_c 166.387 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 120 _cell.pdbx_unique_axis ? _cell.Z_PDB 18 # _symmetry.entry_id 1RSZ _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 155 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Purine nucleoside phosphorylase' 32184.877 1 2.4.2.1 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 non-polymer syn '7-[[(3R,4R)-3-(hydroxymethyl)-4-oxidanyl-pyrrolidin-1-ium-1-yl]methyl]-3,5-dihydropyrrolo[3,2-d]pyrimidin-4-one' 265.288 1 ? ? ? ? 4 water nat water 18.015 63 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Inosine phosphorylase, PNP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVM MQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFP AMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS ; _entity_poly.pdbx_seq_one_letter_code_can ;MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVM MQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFP AMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASN n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 TYR n 1 8 GLU n 1 9 ASP n 1 10 TYR n 1 11 LYS n 1 12 ASN n 1 13 THR n 1 14 ALA n 1 15 GLU n 1 16 TRP n 1 17 LEU n 1 18 LEU n 1 19 SER n 1 20 HIS n 1 21 THR n 1 22 LYS n 1 23 HIS n 1 24 ARG n 1 25 PRO n 1 26 GLN n 1 27 VAL n 1 28 ALA n 1 29 ILE n 1 30 ILE n 1 31 CYS n 1 32 GLY n 1 33 SER n 1 34 GLY n 1 35 LEU n 1 36 GLY n 1 37 GLY n 1 38 LEU n 1 39 THR n 1 40 ASP n 1 41 LYS n 1 42 LEU n 1 43 THR n 1 44 GLN n 1 45 ALA n 1 46 GLN n 1 47 ILE n 1 48 PHE n 1 49 ASP n 1 50 TYR n 1 51 SER n 1 52 GLU n 1 53 ILE n 1 54 PRO n 1 55 ASN n 1 56 PHE n 1 57 PRO n 1 58 ARG n 1 59 SER n 1 60 THR n 1 61 VAL n 1 62 PRO n 1 63 GLY n 1 64 HIS n 1 65 ALA n 1 66 GLY n 1 67 ARG n 1 68 LEU n 1 69 VAL n 1 70 PHE n 1 71 GLY n 1 72 PHE n 1 73 LEU n 1 74 ASN n 1 75 GLY n 1 76 ARG n 1 77 ALA n 1 78 CYS n 1 79 VAL n 1 80 MET n 1 81 MET n 1 82 GLN n 1 83 GLY n 1 84 ARG n 1 85 PHE n 1 86 HIS n 1 87 MET n 1 88 TYR n 1 89 GLU n 1 90 GLY n 1 91 TYR n 1 92 PRO n 1 93 LEU n 1 94 TRP n 1 95 LYS n 1 96 VAL n 1 97 THR n 1 98 PHE n 1 99 PRO n 1 100 VAL n 1 101 ARG n 1 102 VAL n 1 103 PHE n 1 104 HIS n 1 105 LEU n 1 106 LEU n 1 107 GLY n 1 108 VAL n 1 109 ASP n 1 110 THR n 1 111 LEU n 1 112 VAL n 1 113 VAL n 1 114 THR n 1 115 ASN n 1 116 ALA n 1 117 ALA n 1 118 GLY n 1 119 GLY n 1 120 LEU n 1 121 ASN n 1 122 PRO n 1 123 LYS n 1 124 PHE n 1 125 GLU n 1 126 VAL n 1 127 GLY n 1 128 ASP n 1 129 ILE n 1 130 MET n 1 131 LEU n 1 132 ILE n 1 133 ARG n 1 134 ASP n 1 135 HIS n 1 136 ILE n 1 137 ASN n 1 138 LEU n 1 139 PRO n 1 140 GLY n 1 141 PHE n 1 142 SER n 1 143 GLY n 1 144 GLN n 1 145 ASN n 1 146 PRO n 1 147 LEU n 1 148 ARG n 1 149 GLY n 1 150 PRO n 1 151 ASN n 1 152 ASP n 1 153 GLU n 1 154 ARG n 1 155 PHE n 1 156 GLY n 1 157 ASP n 1 158 ARG n 1 159 PHE n 1 160 PRO n 1 161 ALA n 1 162 MET n 1 163 SER n 1 164 ASP n 1 165 ALA n 1 166 TYR n 1 167 ASP n 1 168 ARG n 1 169 THR n 1 170 MET n 1 171 ARG n 1 172 GLN n 1 173 ARG n 1 174 ALA n 1 175 LEU n 1 176 SER n 1 177 THR n 1 178 TRP n 1 179 LYS n 1 180 GLN n 1 181 MET n 1 182 GLY n 1 183 GLU n 1 184 GLN n 1 185 ARG n 1 186 GLU n 1 187 LEU n 1 188 GLN n 1 189 GLU n 1 190 GLY n 1 191 THR n 1 192 TYR n 1 193 VAL n 1 194 MET n 1 195 VAL n 1 196 ALA n 1 197 GLY n 1 198 PRO n 1 199 SER n 1 200 PHE n 1 201 GLU n 1 202 THR n 1 203 VAL n 1 204 ALA n 1 205 GLU n 1 206 CYS n 1 207 ARG n 1 208 VAL n 1 209 LEU n 1 210 GLN n 1 211 LYS n 1 212 LEU n 1 213 GLY n 1 214 ALA n 1 215 ASP n 1 216 ALA n 1 217 VAL n 1 218 GLY n 1 219 MET n 1 220 SER n 1 221 THR n 1 222 VAL n 1 223 PRO n 1 224 GLU n 1 225 VAL n 1 226 ILE n 1 227 VAL n 1 228 ALA n 1 229 ARG n 1 230 HIS n 1 231 CYS n 1 232 GLY n 1 233 LEU n 1 234 ARG n 1 235 VAL n 1 236 PHE n 1 237 GLY n 1 238 PHE n 1 239 SER n 1 240 LEU n 1 241 ILE n 1 242 THR n 1 243 ASN n 1 244 LYS n 1 245 VAL n 1 246 ILE n 1 247 MET n 1 248 ASP n 1 249 TYR n 1 250 GLU n 1 251 SER n 1 252 LEU n 1 253 GLU n 1 254 LYS n 1 255 ALA n 1 256 ASN n 1 257 HIS n 1 258 GLU n 1 259 GLU n 1 260 VAL n 1 261 LEU n 1 262 ALA n 1 263 ALA n 1 264 GLY n 1 265 LYS n 1 266 GLN n 1 267 ALA n 1 268 ALA n 1 269 GLN n 1 270 LYS n 1 271 LEU n 1 272 GLU n 1 273 GLN n 1 274 PHE n 1 275 VAL n 1 276 SER n 1 277 ILE n 1 278 LEU n 1 279 MET n 1 280 ALA n 1 281 SER n 1 282 ILE n 1 283 PRO n 1 284 LEU n 1 285 PRO n 1 286 ASP n 1 287 LYS n 1 288 ALA n 1 289 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'NP, PNP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PNPH_HUMAN _struct_ref.pdbx_db_accession P00491 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVM MQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFP AMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RSZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 289 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00491 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 289 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 289 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DIH non-polymer . '7-[[(3R,4R)-3-(hydroxymethyl)-4-oxidanyl-pyrrolidin-1-ium-1-yl]methyl]-3,5-dihydropyrrolo[3,2-d]pyrimidin-4-one' ? 'C12 H17 N4 O3 1' 265.288 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1RSZ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pdbx_details '1.4 M ammonium sulfate and 100mM sodium citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2002-09-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X9A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X9A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.98 # _reflns.entry_id 1RSZ _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 20.0 _reflns.number_all 31845 _reflns.number_obs 31845 _reflns.percent_possible_obs 97.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.038 _reflns.pdbx_netI_over_sigmaI 30.8 _reflns.B_iso_Wilson_estimate 32.0 _reflns.pdbx_redundancy 4.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.28 _reflns_shell.percent_possible_all 99.1 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.302 _reflns_shell.meanI_over_sigI_obs 3.5 _reflns_shell.pdbx_redundancy 4.3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 3218 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1RSZ _refine.ls_d_res_high 2.20 _refine.ls_d_res_low 20.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 29603 _refine.ls_number_reflns_obs 27975 _refine.ls_number_reflns_R_free 2776 _refine.ls_percent_reflns_obs 85.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.253 _refine.ls_R_factor_R_work 0.25 _refine.ls_R_factor_R_free 0.276 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free 9.9 _refine.ls_R_factor_R_free_error 0.005 _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1B8O _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean 55.8 _refine.aniso_B[1][1] 4.40 _refine.aniso_B[1][2] 4.95 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 4.40 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -8.80 _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1RSZ _refine_analyze.Luzzati_coordinate_error_obs 0.33 _refine_analyze.Luzzati_sigma_a_obs 0.32 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.37 _refine_analyze.Luzzati_sigma_a_free 0.36 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2206 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.number_atoms_solvent 63 _refine_hist.number_atoms_total 2303 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.2 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.87 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.20 _refine_ls_shell.d_res_low 2.34 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.31 _refine_ls_shell.percent_reflns_obs 72.4 _refine_ls_shell.R_factor_R_free 0.337 _refine_ls_shell.R_factor_R_free_error 0.017 _refine_ls_shell.percent_reflns_R_free 10.1 _refine_ls_shell.number_reflns_R_free 394 _refine_ls_shell.number_reflns_obs 3920 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1RSZ _struct.title 'Structure of human purine nucleoside phosphorylase in complex with DADMe-Immucillin-H and sulfate' _struct.pdbx_descriptor 'Purine nucleoside phosphorylase (E.C.2.4.2.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RSZ _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'PNP, transition-state analogue, transferase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a trimer generated from the monomer in the asymmetric unit by crystallographic 3-fold' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? SER A 19 ? THR A 6 SER A 19 1 ? 14 HELX_P HELX_P2 2 LEU A 35 ? LEU A 42 ? LEU A 35 LEU A 42 5 ? 8 HELX_P HELX_P3 3 SER A 51 ? ILE A 53 ? SER A 51 ILE A 53 5 ? 3 HELX_P HELX_P4 4 HIS A 86 ? GLY A 90 ? HIS A 86 GLY A 90 5 ? 5 HELX_P HELX_P5 5 PRO A 92 ? THR A 97 ? PRO A 92 THR A 97 1 ? 6 HELX_P HELX_P6 6 THR A 97 ? LEU A 106 ? THR A 97 LEU A 106 1 ? 10 HELX_P HELX_P7 7 LEU A 138 ? GLY A 143 ? LEU A 138 GLY A 143 1 ? 6 HELX_P HELX_P8 8 ASP A 167 ? GLN A 180 ? ASP A 167 GLN A 180 1 ? 14 HELX_P HELX_P9 9 THR A 202 ? LEU A 212 ? THR A 202 LEU A 212 1 ? 11 HELX_P HELX_P10 10 THR A 221 ? GLY A 232 ? THR A 221 GLY A 232 1 ? 12 HELX_P HELX_P11 11 ASN A 256 ? ALA A 267 ? ASN A 256 ALA A 267 1 ? 12 HELX_P HELX_P12 12 ALA A 267 ? ILE A 282 ? ALA A 267 ILE A 282 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 197 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 197 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 198 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 198 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.48 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? anti-parallel A 7 8 ? parallel A 8 9 ? parallel A 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 43 ? ASP A 49 ? THR A 43 ASP A 49 A 2 ARG A 67 ? LEU A 73 ? ARG A 67 LEU A 73 A 3 ARG A 76 ? GLN A 82 ? ARG A 76 GLN A 82 A 4 VAL A 27 ? CYS A 31 ? VAL A 27 CYS A 31 A 5 THR A 110 ? GLY A 119 ? THR A 110 GLY A 119 A 6 ARG A 234 ? LYS A 244 ? ARG A 234 LYS A 244 A 7 ILE A 129 ? ASN A 137 ? ILE A 129 ASN A 137 A 8 GLN A 188 ? MET A 194 ? GLN A 188 MET A 194 A 9 ALA A 216 ? GLY A 218 ? ALA A 216 GLY A 218 A 10 THR A 110 ? GLY A 119 ? THR A 110 GLY A 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 48 ? N PHE A 48 O LEU A 68 ? O LEU A 68 A 2 3 N GLY A 71 ? N GLY A 71 O CYS A 78 ? O CYS A 78 A 3 4 O MET A 81 ? O MET A 81 N ILE A 29 ? N ILE A 29 A 4 5 N ALA A 28 ? N ALA A 28 O THR A 110 ? O THR A 110 A 5 6 N GLY A 119 ? N GLY A 119 O ASN A 243 ? O ASN A 243 A 6 7 O SER A 239 ? O SER A 239 N MET A 130 ? N MET A 130 A 7 8 N LEU A 131 ? N LEU A 131 O GLY A 190 ? O GLY A 190 A 8 9 N VAL A 193 ? N VAL A 193 O ALA A 216 ? O ALA A 216 A 9 10 O VAL A 217 ? O VAL A 217 N GLY A 118 ? N GLY A 118 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 A 401' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 402' AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 403' AC4 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE DIH A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 SER A 33 ? SER A 33 . ? 1_555 ? 2 AC1 9 ARG A 84 ? ARG A 84 . ? 1_555 ? 3 AC1 9 HIS A 86 ? HIS A 86 . ? 1_555 ? 4 AC1 9 ASN A 115 ? ASN A 115 . ? 1_555 ? 5 AC1 9 ALA A 116 ? ALA A 116 . ? 1_555 ? 6 AC1 9 SER A 220 ? SER A 220 . ? 1_555 ? 7 AC1 9 DIH E . ? DIH A 300 . ? 1_555 ? 8 AC1 9 HOH F . ? HOH A 501 . ? 1_555 ? 9 AC1 9 HOH F . ? HOH A 515 . ? 1_555 ? 10 AC2 6 PRO A 92 ? PRO A 92 . ? 3_555 ? 11 AC2 6 GLN A 144 ? GLN A 144 . ? 3_555 ? 12 AC2 6 ARG A 148 ? ARG A 148 . ? 1_555 ? 13 AC2 6 HOH F . ? HOH A 502 . ? 3_555 ? 14 AC2 6 HOH F . ? HOH A 514 . ? 1_555 ? 15 AC2 6 HOH F . ? HOH A 525 . ? 1_555 ? 16 AC3 4 ASN A 3 ? ASN A 3 . ? 1_555 ? 17 AC3 4 GLY A 90 ? GLY A 90 . ? 3_555 ? 18 AC3 4 ARG A 148 ? ARG A 148 . ? 1_555 ? 19 AC3 4 GLY A 149 ? GLY A 149 . ? 1_555 ? 20 AC4 17 TYR A 88 ? TYR A 88 . ? 1_555 ? 21 AC4 17 ALA A 116 ? ALA A 116 . ? 1_555 ? 22 AC4 17 ALA A 117 ? ALA A 117 . ? 1_555 ? 23 AC4 17 GLY A 118 ? GLY A 118 . ? 1_555 ? 24 AC4 17 PHE A 159 ? PHE A 159 . ? 2_555 ? 25 AC4 17 PHE A 200 ? PHE A 200 . ? 1_555 ? 26 AC4 17 GLU A 201 ? GLU A 201 . ? 1_555 ? 27 AC4 17 VAL A 217 ? VAL A 217 . ? 1_555 ? 28 AC4 17 GLY A 218 ? GLY A 218 . ? 1_555 ? 29 AC4 17 MET A 219 ? MET A 219 . ? 1_555 ? 30 AC4 17 THR A 242 ? THR A 242 . ? 1_555 ? 31 AC4 17 ASN A 243 ? ASN A 243 . ? 1_555 ? 32 AC4 17 VAL A 245 ? VAL A 245 . ? 1_555 ? 33 AC4 17 HIS A 257 ? HIS A 257 . ? 1_555 ? 34 AC4 17 VAL A 260 ? VAL A 260 . ? 1_555 ? 35 AC4 17 SO4 B . ? SO4 A 401 . ? 1_555 ? 36 AC4 17 HOH F . ? HOH A 536 . ? 1_555 ? # _database_PDB_matrix.entry_id 1RSZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RSZ _atom_sites.fract_transf_matrix[1][1] 0.007034 _atom_sites.fract_transf_matrix[1][2] 0.004061 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008122 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006010 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 TRP 94 94 94 TRP TRP A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 MET 162 162 162 MET MET A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 TYR 166 166 166 TYR TYR A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 MET 170 170 170 MET MET A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 TRP 178 178 178 TRP TRP A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 MET 181 181 181 MET MET A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 GLN 188 188 188 GLN GLN A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 MET 194 194 194 MET MET A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 PHE 200 200 200 PHE PHE A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 THR 202 202 202 THR THR A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 CYS 206 206 206 CYS CYS A . n A 1 207 ARG 207 207 207 ARG ARG A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 MET 219 219 219 MET MET A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ARG 229 229 229 ARG ARG A . n A 1 230 HIS 230 230 230 HIS HIS A . n A 1 231 CYS 231 231 231 CYS CYS A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 PHE 236 236 236 PHE PHE A . n A 1 237 GLY 237 237 237 GLY GLY A . n A 1 238 PHE 238 238 238 PHE PHE A . n A 1 239 SER 239 239 239 SER SER A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 ASN 243 243 243 ASN ASN A . n A 1 244 LYS 244 244 244 LYS LYS A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 MET 247 247 247 MET MET A . n A 1 248 ASP 248 248 248 ASP ASP A . n A 1 249 TYR 249 249 249 TYR TYR A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 LYS 254 254 254 LYS LYS A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 ASN 256 256 256 ASN ASN A . n A 1 257 HIS 257 257 257 HIS HIS A . n A 1 258 GLU 258 258 258 GLU GLU A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 VAL 260 260 260 VAL VAL A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 ALA 262 262 262 ALA ALA A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 GLY 264 264 264 GLY GLY A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 GLN 269 269 269 GLN GLN A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 GLN 273 273 273 GLN GLN A . n A 1 274 PHE 274 274 274 PHE PHE A . n A 1 275 VAL 275 275 275 VAL VAL A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 ILE 277 277 277 ILE ILE A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 MET 279 279 279 MET MET A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 ILE 282 282 282 ILE ILE A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 PRO 285 285 ? ? ? A . n A 1 286 ASP 286 286 ? ? ? A . n A 1 287 LYS 287 287 ? ? ? A . n A 1 288 ALA 288 288 ? ? ? A . n A 1 289 SER 289 289 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 401 SO4 SO4 A . C 2 SO4 1 402 402 SO4 SO4 A . D 2 SO4 1 403 403 SO4 SO4 A . E 3 DIH 1 300 300 DIH DIH A . F 4 HOH 1 501 501 HOH HOH A . F 4 HOH 2 502 502 HOH HOH A . F 4 HOH 3 503 503 HOH HOH A . F 4 HOH 4 504 504 HOH HOH A . F 4 HOH 5 505 505 HOH HOH A . F 4 HOH 6 506 506 HOH HOH A . F 4 HOH 7 507 507 HOH HOH A . F 4 HOH 8 508 508 HOH HOH A . F 4 HOH 9 509 509 HOH HOH A . F 4 HOH 10 510 510 HOH HOH A . F 4 HOH 11 511 511 HOH HOH A . F 4 HOH 12 512 512 HOH HOH A . F 4 HOH 13 513 513 HOH HOH A . F 4 HOH 14 514 514 HOH HOH A . F 4 HOH 15 515 515 HOH HOH A . F 4 HOH 16 516 516 HOH HOH A . F 4 HOH 17 517 517 HOH HOH A . F 4 HOH 18 518 518 HOH HOH A . F 4 HOH 19 519 519 HOH HOH A . F 4 HOH 20 520 520 HOH HOH A . F 4 HOH 21 521 521 HOH HOH A . F 4 HOH 22 522 522 HOH HOH A . F 4 HOH 23 523 523 HOH HOH A . F 4 HOH 24 524 524 HOH HOH A . F 4 HOH 25 525 525 HOH HOH A . F 4 HOH 26 526 526 HOH HOH A . F 4 HOH 27 527 527 HOH HOH A . F 4 HOH 28 528 528 HOH HOH A . F 4 HOH 29 529 529 HOH HOH A . F 4 HOH 30 530 530 HOH HOH A . F 4 HOH 31 531 531 HOH HOH A . F 4 HOH 32 532 532 HOH HOH A . F 4 HOH 33 533 533 HOH HOH A . F 4 HOH 34 534 534 HOH HOH A . F 4 HOH 35 535 535 HOH HOH A . F 4 HOH 36 536 536 HOH HOH A . F 4 HOH 37 537 537 HOH HOH A . F 4 HOH 38 538 538 HOH HOH A . F 4 HOH 39 539 539 HOH HOH A . F 4 HOH 40 540 540 HOH HOH A . F 4 HOH 41 541 541 HOH HOH A . F 4 HOH 42 542 542 HOH HOH A . F 4 HOH 43 543 543 HOH HOH A . F 4 HOH 44 544 544 HOH HOH A . F 4 HOH 45 545 545 HOH HOH A . F 4 HOH 46 546 546 HOH HOH A . F 4 HOH 47 547 547 HOH HOH A . F 4 HOH 48 548 548 HOH HOH A . F 4 HOH 49 549 549 HOH HOH A . F 4 HOH 50 550 550 HOH HOH A . F 4 HOH 51 551 551 HOH HOH A . F 4 HOH 52 552 552 HOH HOH A . F 4 HOH 53 553 553 HOH HOH A . F 4 HOH 54 554 554 HOH HOH A . F 4 HOH 55 555 555 HOH HOH A . F 4 HOH 56 556 556 HOH HOH A . F 4 HOH 57 557 557 HOH HOH A . F 4 HOH 58 558 558 HOH HOH A . F 4 HOH 59 559 559 HOH HOH A . F 4 HOH 60 560 560 HOH HOH A . F 4 HOH 61 561 561 HOH HOH A . F 4 HOH 62 562 562 HOH HOH A . F 4 HOH 63 563 563 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11600 ? 1 MORE -191 ? 1 'SSA (A^2)' 29930 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-02-22 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2018-12-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Non-polymer description' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp 2 4 'Structure model' entity 3 4 'Structure model' pdbx_entity_nonpoly 4 4 'Structure model' pdbx_validate_chiral # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_chem_comp.formula' 2 4 'Structure model' '_chem_comp.formula_weight' 3 4 'Structure model' '_chem_comp.name' 4 4 'Structure model' '_chem_comp.pdbx_synonyms' 5 4 'Structure model' '_entity.formula_weight' 6 4 'Structure model' '_entity.pdbx_description' 7 4 'Structure model' '_pdbx_entity_nonpoly.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 AMoRE phasing . ? 3 CNS refinement 1.0 ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 59 ? ? -46.63 158.10 2 1 THR A 60 ? ? -96.41 -98.98 3 1 VAL A 61 ? ? -150.03 35.23 4 1 ASP A 167 ? ? -37.30 109.77 5 1 SER A 220 ? ? -151.82 -157.82 6 1 THR A 221 ? ? 66.70 -59.25 7 1 ILE A 241 ? ? -69.02 99.98 8 1 ALA A 268 ? ? -49.75 -91.94 9 1 PRO A 283 ? ? -58.48 -161.67 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A PRO 285 ? A PRO 285 4 1 Y 1 A ASP 286 ? A ASP 286 5 1 Y 1 A LYS 287 ? A LYS 287 6 1 Y 1 A ALA 288 ? A ALA 288 7 1 Y 1 A SER 289 ? A SER 289 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 '7-[[(3R,4R)-3-(hydroxymethyl)-4-oxidanyl-pyrrolidin-1-ium-1-yl]methyl]-3,5-dihydropyrrolo[3,2-d]pyrimidin-4-one' DIH 4 water HOH #