data_1RXR # _entry.id 1RXR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RXR pdb_00001rxr 10.2210/pdb1rxr/pdb WWPDB D_1000176268 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-11-11 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-03-14 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_nmr_software 9 5 'Structure model' struct_conn 10 5 'Structure model' struct_ref_seq_dif 11 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 4 'Structure model' '_struct_ref_seq_dif.details' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_pdbx_nmr_software.name' 6 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 5 'Structure model' '_struct_ref_seq_dif.details' 19 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RXR _pdbx_database_status.recvd_initial_deposition_date 1998-06-12 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Holmbeck, S.M.A.' 1 'Foster, M.P.' 2 'Casimiro, D.R.' 3 'Sem, D.S.' 4 'Dyson, H.J.' 5 'Wright, P.E.' 6 # _citation.id primary _citation.title 'High-resolution solution structure of the retinoid X receptor DNA-binding domain.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 281 _citation.page_first 271 _citation.page_last 284 _citation.year 1998 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9698548 _citation.pdbx_database_id_DOI 10.1006/jmbi.1998.1908 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Holmbeck, S.M.' 1 ? primary 'Foster, M.P.' 2 ? primary 'Casimiro, D.R.' 3 ? primary 'Sem, D.S.' 4 ? primary 'Dyson, H.J.' 5 ? primary 'Wright, P.E.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RETINOIC ACID RECEPTOR-ALPHA' 9817.389 1 ? C195A 'DNA-BINDING DOMAIN, 130-212' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name RXR-ALPHA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;FTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKALAMGMKREAVQEER QRG ; _entity_poly.pdbx_seq_one_letter_code_can ;FTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKALAMGMKREAVQEER QRG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PHE n 1 2 THR n 1 3 LYS n 1 4 HIS n 1 5 ILE n 1 6 CYS n 1 7 ALA n 1 8 ILE n 1 9 CYS n 1 10 GLY n 1 11 ASP n 1 12 ARG n 1 13 SER n 1 14 SER n 1 15 GLY n 1 16 LYS n 1 17 HIS n 1 18 TYR n 1 19 GLY n 1 20 VAL n 1 21 TYR n 1 22 SER n 1 23 CYS n 1 24 GLU n 1 25 GLY n 1 26 CYS n 1 27 LYS n 1 28 GLY n 1 29 PHE n 1 30 PHE n 1 31 LYS n 1 32 ARG n 1 33 THR n 1 34 VAL n 1 35 ARG n 1 36 LYS n 1 37 ASP n 1 38 LEU n 1 39 THR n 1 40 TYR n 1 41 THR n 1 42 CYS n 1 43 ARG n 1 44 ASP n 1 45 ASN n 1 46 LYS n 1 47 ASP n 1 48 CYS n 1 49 LEU n 1 50 ILE n 1 51 ASP n 1 52 LYS n 1 53 ARG n 1 54 GLN n 1 55 ARG n 1 56 ASN n 1 57 ARG n 1 58 CYS n 1 59 GLN n 1 60 TYR n 1 61 CYS n 1 62 ARG n 1 63 TYR n 1 64 GLN n 1 65 LYS n 1 66 ALA n 1 67 LEU n 1 68 ALA n 1 69 MET n 1 70 GLY n 1 71 MET n 1 72 LYS n 1 73 ARG n 1 74 GLU n 1 75 ALA n 1 76 VAL n 1 77 GLN n 1 78 GLU n 1 79 GLU n 1 80 ARG n 1 81 GLN n 1 82 ARG n 1 83 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET24A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PHE 1 130 130 PHE PHE A . n A 1 2 THR 2 131 131 THR THR A . n A 1 3 LYS 3 132 132 LYS LYS A . n A 1 4 HIS 4 133 133 HIS HIS A . n A 1 5 ILE 5 134 134 ILE ILE A . n A 1 6 CYS 6 135 135 CYS CYS A . n A 1 7 ALA 7 136 136 ALA ALA A . n A 1 8 ILE 8 137 137 ILE ILE A . n A 1 9 CYS 9 138 138 CYS CYS A . n A 1 10 GLY 10 139 139 GLY GLY A . n A 1 11 ASP 11 140 140 ASP ASP A . n A 1 12 ARG 12 141 141 ARG ARG A . n A 1 13 SER 13 142 142 SER SER A . n A 1 14 SER 14 143 143 SER SER A . n A 1 15 GLY 15 144 144 GLY GLY A . n A 1 16 LYS 16 145 145 LYS LYS A . n A 1 17 HIS 17 146 146 HIS HIS A . n A 1 18 TYR 18 147 147 TYR TYR A . n A 1 19 GLY 19 148 148 GLY GLY A . n A 1 20 VAL 20 149 149 VAL VAL A . n A 1 21 TYR 21 150 150 TYR TYR A . n A 1 22 SER 22 151 151 SER SER A . n A 1 23 CYS 23 152 152 CYS CYS A . n A 1 24 GLU 24 153 153 GLU GLU A . n A 1 25 GLY 25 154 154 GLY GLY A . n A 1 26 CYS 26 155 155 CYS CYS A . n A 1 27 LYS 27 156 156 LYS LYS A . n A 1 28 GLY 28 157 157 GLY GLY A . n A 1 29 PHE 29 158 158 PHE PHE A . n A 1 30 PHE 30 159 159 PHE PHE A . n A 1 31 LYS 31 160 160 LYS LYS A . n A 1 32 ARG 32 161 161 ARG ARG A . n A 1 33 THR 33 162 162 THR THR A . n A 1 34 VAL 34 163 163 VAL VAL A . n A 1 35 ARG 35 164 164 ARG ARG A . n A 1 36 LYS 36 165 165 LYS LYS A . n A 1 37 ASP 37 166 166 ASP ASP A . n A 1 38 LEU 38 167 167 LEU LEU A . n A 1 39 THR 39 168 168 THR THR A . n A 1 40 TYR 40 169 169 TYR TYR A . n A 1 41 THR 41 170 170 THR THR A . n A 1 42 CYS 42 171 171 CYS CYS A . n A 1 43 ARG 43 172 172 ARG ARG A . n A 1 44 ASP 44 173 173 ASP ASP A . n A 1 45 ASN 45 174 174 ASN ASN A . n A 1 46 LYS 46 175 175 LYS LYS A . n A 1 47 ASP 47 176 176 ASP ASP A . n A 1 48 CYS 48 177 177 CYS CYS A . n A 1 49 LEU 49 178 178 LEU LEU A . n A 1 50 ILE 50 179 179 ILE ILE A . n A 1 51 ASP 51 180 180 ASP ASP A . n A 1 52 LYS 52 181 181 LYS LYS A . n A 1 53 ARG 53 182 182 ARG ARG A . n A 1 54 GLN 54 183 183 GLN GLN A . n A 1 55 ARG 55 184 184 ARG ARG A . n A 1 56 ASN 56 185 185 ASN ASN A . n A 1 57 ARG 57 186 186 ARG ARG A . n A 1 58 CYS 58 187 187 CYS CYS A . n A 1 59 GLN 59 188 188 GLN GLN A . n A 1 60 TYR 60 189 189 TYR TYR A . n A 1 61 CYS 61 190 190 CYS CYS A . n A 1 62 ARG 62 191 191 ARG ARG A . n A 1 63 TYR 63 192 192 TYR TYR A . n A 1 64 GLN 64 193 193 GLN GLN A . n A 1 65 LYS 65 194 194 LYS LYS A . n A 1 66 ALA 66 195 195 ALA ALA A . n A 1 67 LEU 67 196 196 LEU LEU A . n A 1 68 ALA 68 197 197 ALA ALA A . n A 1 69 MET 69 198 198 MET MET A . n A 1 70 GLY 70 199 199 GLY GLY A . n A 1 71 MET 71 200 200 MET MET A . n A 1 72 LYS 72 201 201 LYS LYS A . n A 1 73 ARG 73 202 202 ARG ARG A . n A 1 74 GLU 74 203 203 GLU GLU A . n A 1 75 ALA 75 204 204 ALA ALA A . n A 1 76 VAL 76 205 205 VAL VAL A . n A 1 77 GLN 77 206 206 GLN GLN A . n A 1 78 GLU 78 207 207 GLU GLU A . n A 1 79 GLU 79 208 208 GLU GLU A . n A 1 80 ARG 80 209 209 ARG ARG A . n A 1 81 GLN 81 210 210 GLN GLN A . n A 1 82 ARG 82 211 211 ARG ARG A . n A 1 83 GLY 83 212 212 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 213 213 ZN ZN A . C 2 ZN 1 214 214 ZN ZN A . # _software.name AMBER _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _cell.entry_id 1RXR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RXR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1RXR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1RXR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1RXR _struct.title 'HIGH RESOLUTION SOLUTION STRUCTURE OF THE RETINOID X RECEPTOR DNA BINDING DOMAIN, NMR, 20 STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RXR _struct_keywords.pdbx_keywords 'TRANSCRIPTION FACTOR' _struct_keywords.text 'TRANSCRIPTION FACTOR, NUCLEAR HORMONE RECEPTOR, ZINC-FINGER' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RXRA_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P19793 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVP TTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFK RTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAV KDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASL EAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RXR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19793 _struct_ref_seq.db_align_beg 130 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 212 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 130 _struct_ref_seq.pdbx_auth_seq_align_end 212 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1RXR _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 66 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P19793 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 195 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 195 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 24 ? LYS A 36 ? GLU A 153 LYS A 165 1 ? 13 HELX_P HELX_P2 2 GLN A 59 ? MET A 69 ? GLN A 188 MET A 198 1 ? 11 HELX_P HELX_P3 3 ARG A 73 ? GLU A 78 ? ARG A 202 GLU A 207 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 6 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 135 A ZN 213 1_555 ? ? ? ? ? ? ? 2.288 ? ? metalc2 metalc ? ? A CYS 9 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 138 A ZN 213 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc3 metalc ? ? A CYS 23 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 152 A ZN 213 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc4 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 155 A ZN 213 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc5 metalc ? ? A CYS 42 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 171 A ZN 214 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc6 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 177 A ZN 214 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc7 metalc ? ? A CYS 58 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 187 A ZN 214 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc8 metalc ? ? A CYS 61 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 190 A ZN 214 1_555 ? ? ? ? ? ? ? 2.298 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 6 ? A CYS 135 ? 1_555 ZN ? B ZN . ? A ZN 213 ? 1_555 SG ? A CYS 9 ? A CYS 138 ? 1_555 108.2 ? 2 SG ? A CYS 6 ? A CYS 135 ? 1_555 ZN ? B ZN . ? A ZN 213 ? 1_555 SG ? A CYS 23 ? A CYS 152 ? 1_555 110.0 ? 3 SG ? A CYS 9 ? A CYS 138 ? 1_555 ZN ? B ZN . ? A ZN 213 ? 1_555 SG ? A CYS 23 ? A CYS 152 ? 1_555 108.5 ? 4 SG ? A CYS 6 ? A CYS 135 ? 1_555 ZN ? B ZN . ? A ZN 213 ? 1_555 SG ? A CYS 26 ? A CYS 155 ? 1_555 108.2 ? 5 SG ? A CYS 9 ? A CYS 138 ? 1_555 ZN ? B ZN . ? A ZN 213 ? 1_555 SG ? A CYS 26 ? A CYS 155 ? 1_555 112.5 ? 6 SG ? A CYS 23 ? A CYS 152 ? 1_555 ZN ? B ZN . ? A ZN 213 ? 1_555 SG ? A CYS 26 ? A CYS 155 ? 1_555 109.3 ? 7 SG ? A CYS 42 ? A CYS 171 ? 1_555 ZN ? C ZN . ? A ZN 214 ? 1_555 SG ? A CYS 48 ? A CYS 177 ? 1_555 112.9 ? 8 SG ? A CYS 42 ? A CYS 171 ? 1_555 ZN ? C ZN . ? A ZN 214 ? 1_555 SG ? A CYS 58 ? A CYS 187 ? 1_555 107.7 ? 9 SG ? A CYS 48 ? A CYS 177 ? 1_555 ZN ? C ZN . ? A ZN 214 ? 1_555 SG ? A CYS 58 ? A CYS 187 ? 1_555 110.8 ? 10 SG ? A CYS 42 ? A CYS 171 ? 1_555 ZN ? C ZN . ? A ZN 214 ? 1_555 SG ? A CYS 61 ? A CYS 190 ? 1_555 108.3 ? 11 SG ? A CYS 48 ? A CYS 177 ? 1_555 ZN ? C ZN . ? A ZN 214 ? 1_555 SG ? A CYS 61 ? A CYS 190 ? 1_555 109.0 ? 12 SG ? A CYS 58 ? A CYS 187 ? 1_555 ZN ? C ZN . ? A ZN 214 ? 1_555 SG ? A CYS 61 ? A CYS 190 ? 1_555 108.1 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 15 ? HIS A 17 ? GLY A 144 HIS A 146 A 2 VAL A 20 ? SER A 22 ? VAL A 149 SER A 151 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id GLY _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 15 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 144 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id SER _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 22 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id SER _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 151 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 213 ? 4 'BINDING SITE FOR RESIDUE ZN A 213' AC2 Software A ZN 214 ? 4 'BINDING SITE FOR RESIDUE ZN A 214' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 6 ? CYS A 135 . ? 1_555 ? 2 AC1 4 CYS A 9 ? CYS A 138 . ? 1_555 ? 3 AC1 4 CYS A 23 ? CYS A 152 . ? 1_555 ? 4 AC1 4 CYS A 26 ? CYS A 155 . ? 1_555 ? 5 AC2 4 CYS A 42 ? CYS A 171 . ? 1_555 ? 6 AC2 4 CYS A 48 ? CYS A 177 . ? 1_555 ? 7 AC2 4 CYS A 58 ? CYS A 187 . ? 1_555 ? 8 AC2 4 CYS A 61 ? CYS A 190 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 CA A CYS 177 ? ? CB A CYS 177 ? ? SG A CYS 177 ? ? 121.73 114.20 7.53 1.10 N 2 14 NE A ARG 164 ? ? CZ A ARG 164 ? ? NH2 A ARG 164 ? ? 117.18 120.30 -3.12 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 133 ? ? -69.06 70.89 2 1 ILE A 137 ? ? -80.63 -73.56 3 1 ASN A 185 ? ? -58.42 -8.87 4 1 LYS A 201 ? ? -69.90 73.78 5 2 THR A 131 ? ? 71.97 -60.75 6 2 CYS A 177 ? ? -50.69 99.18 7 2 CYS A 187 ? ? -150.87 35.84 8 2 LYS A 201 ? ? -67.75 85.42 9 2 GLN A 206 ? ? -80.28 38.76 10 3 LEU A 167 ? ? -63.89 94.28 11 3 ARG A 172 ? ? -75.68 48.00 12 3 LYS A 201 ? ? -69.37 85.62 13 4 HIS A 133 ? ? -47.38 156.09 14 4 ARG A 172 ? ? -76.75 46.76 15 4 ASP A 173 ? ? -160.25 -109.06 16 4 CYS A 177 ? ? -67.91 66.33 17 4 ARG A 182 ? ? -112.30 63.20 18 4 LYS A 201 ? ? -70.00 86.25 19 5 HIS A 133 ? ? -60.14 -177.57 20 5 ASP A 173 ? ? -156.12 -139.29 21 5 LYS A 201 ? ? -68.88 79.68 22 6 ASP A 173 ? ? -131.36 -135.11 23 6 ASN A 174 ? ? -129.10 -158.22 24 6 LYS A 175 ? ? -54.27 -4.96 25 6 GLN A 183 ? ? -71.55 45.43 26 6 GLN A 188 ? ? -42.34 -79.68 27 6 LYS A 201 ? ? -65.38 84.27 28 7 THR A 131 ? ? -60.93 -70.25 29 7 ASN A 174 ? ? -86.28 -150.12 30 7 LYS A 175 ? ? -54.44 -6.78 31 7 LYS A 201 ? ? -64.82 84.61 32 8 THR A 131 ? ? 70.17 -56.68 33 8 ILE A 137 ? ? -80.97 -78.90 34 8 ASP A 173 ? ? -149.67 -127.11 35 8 LYS A 201 ? ? -66.23 82.01 36 8 ARG A 211 ? ? -63.96 69.09 37 9 CYS A 187 ? ? -154.14 34.68 38 9 LYS A 201 ? ? -69.89 82.89 39 9 GLN A 206 ? ? -90.14 38.85 40 9 GLU A 207 ? ? -84.38 -77.64 41 9 ARG A 209 ? ? -74.12 43.95 42 10 ARG A 186 ? ? -38.69 -38.47 43 10 CYS A 187 ? ? -79.14 50.00 44 10 LYS A 201 ? ? -66.68 86.96 45 10 ARG A 209 ? ? -38.96 131.39 46 11 THR A 131 ? ? 70.54 -69.50 47 11 ASP A 173 ? ? -99.98 -110.22 48 11 CYS A 177 ? ? -69.55 72.14 49 11 ARG A 209 ? ? -106.07 72.19 50 12 THR A 131 ? ? 67.88 -63.99 51 12 ILE A 137 ? ? -80.91 -77.05 52 12 LYS A 175 ? ? -52.82 6.33 53 12 LYS A 201 ? ? -67.34 82.25 54 13 LYS A 201 ? ? -67.24 84.93 55 14 THR A 131 ? ? -47.25 -70.62 56 14 HIS A 133 ? ? -67.30 76.22 57 14 CYS A 138 ? ? -142.15 11.31 58 14 LYS A 175 ? ? -49.26 -19.09 59 14 ASN A 185 ? ? -68.54 50.32 60 14 LYS A 201 ? ? -67.39 84.27 61 14 ARG A 209 ? ? -109.47 59.59 62 14 ARG A 211 ? ? -69.09 70.94 63 15 ASP A 166 ? ? 75.30 59.29 64 15 ASP A 173 ? ? -153.13 -98.36 65 15 ARG A 182 ? ? -113.75 76.68 66 15 ARG A 184 ? ? -69.47 68.50 67 15 ARG A 186 ? ? -76.22 46.15 68 15 CYS A 187 ? ? -78.12 45.14 69 15 LYS A 201 ? ? -68.77 79.26 70 16 HIS A 133 ? ? -39.49 111.01 71 16 ASP A 166 ? ? 71.17 59.49 72 16 LYS A 181 ? ? -39.75 -75.15 73 16 ARG A 186 ? ? -153.34 -14.76 74 16 CYS A 187 ? ? -80.83 47.65 75 16 LYS A 201 ? ? -67.95 79.85 76 17 CYS A 138 ? ? -139.61 -32.71 77 17 ASP A 173 ? ? -156.50 -126.63 78 17 LYS A 181 ? ? -39.23 -39.60 79 17 CYS A 187 ? ? -89.15 46.86 80 17 LYS A 201 ? ? -67.06 86.23 81 18 ASP A 173 ? ? -153.16 -134.98 82 18 ARG A 184 ? ? -37.05 -39.40 83 18 ASN A 185 ? ? -141.31 48.19 84 18 LYS A 201 ? ? -68.89 86.26 85 19 HIS A 133 ? ? -36.40 91.72 86 19 CYS A 138 ? ? -149.28 14.01 87 19 ASP A 173 ? ? -150.00 -106.64 88 19 CYS A 187 ? ? -63.75 76.03 89 19 LYS A 201 ? ? -66.60 82.04 90 20 LEU A 167 ? ? -59.34 102.66 91 20 ASN A 174 ? ? -79.50 -162.14 92 20 LYS A 175 ? ? -54.95 -0.69 93 20 LYS A 201 ? ? -68.90 82.15 94 20 ARG A 209 ? ? -109.29 66.50 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 147 ? ? 0.088 'SIDE CHAIN' 2 1 ARG A 161 ? ? 0.079 'SIDE CHAIN' 3 1 ARG A 172 ? ? 0.120 'SIDE CHAIN' 4 1 TYR A 192 ? ? 0.143 'SIDE CHAIN' 5 2 TYR A 150 ? ? 0.111 'SIDE CHAIN' 6 2 TYR A 189 ? ? 0.068 'SIDE CHAIN' 7 2 TYR A 192 ? ? 0.141 'SIDE CHAIN' 8 3 TYR A 169 ? ? 0.087 'SIDE CHAIN' 9 3 ARG A 182 ? ? 0.096 'SIDE CHAIN' 10 4 TYR A 192 ? ? 0.159 'SIDE CHAIN' 11 5 ARG A 141 ? ? 0.095 'SIDE CHAIN' 12 5 TYR A 189 ? ? 0.076 'SIDE CHAIN' 13 5 TYR A 192 ? ? 0.159 'SIDE CHAIN' 14 6 TYR A 169 ? ? 0.292 'SIDE CHAIN' 15 6 TYR A 189 ? ? 0.071 'SIDE CHAIN' 16 8 TYR A 189 ? ? 0.075 'SIDE CHAIN' 17 8 TYR A 192 ? ? 0.074 'SIDE CHAIN' 18 9 PHE A 158 ? ? 0.089 'SIDE CHAIN' 19 9 TYR A 189 ? ? 0.074 'SIDE CHAIN' 20 9 TYR A 192 ? ? 0.165 'SIDE CHAIN' 21 9 ARG A 209 ? ? 0.096 'SIDE CHAIN' 22 10 TYR A 150 ? ? 0.088 'SIDE CHAIN' 23 10 PHE A 158 ? ? 0.100 'SIDE CHAIN' 24 10 ARG A 161 ? ? 0.086 'SIDE CHAIN' 25 10 TYR A 189 ? ? 0.086 'SIDE CHAIN' 26 10 TYR A 192 ? ? 0.137 'SIDE CHAIN' 27 11 PHE A 158 ? ? 0.081 'SIDE CHAIN' 28 11 TYR A 169 ? ? 0.094 'SIDE CHAIN' 29 11 ARG A 184 ? ? 0.098 'SIDE CHAIN' 30 11 TYR A 189 ? ? 0.102 'SIDE CHAIN' 31 11 TYR A 192 ? ? 0.083 'SIDE CHAIN' 32 12 TYR A 169 ? ? 0.082 'SIDE CHAIN' 33 13 TYR A 169 ? ? 0.110 'SIDE CHAIN' 34 13 ARG A 186 ? ? 0.103 'SIDE CHAIN' 35 13 TYR A 192 ? ? 0.075 'SIDE CHAIN' 36 14 TYR A 169 ? ? 0.106 'SIDE CHAIN' 37 14 ARG A 184 ? ? 0.101 'SIDE CHAIN' 38 14 TYR A 189 ? ? 0.073 'SIDE CHAIN' 39 14 TYR A 192 ? ? 0.072 'SIDE CHAIN' 40 15 TYR A 150 ? ? 0.094 'SIDE CHAIN' 41 15 TYR A 169 ? ? 0.084 'SIDE CHAIN' 42 16 ARG A 141 ? ? 0.079 'SIDE CHAIN' 43 16 TYR A 150 ? ? 0.081 'SIDE CHAIN' 44 16 TYR A 169 ? ? 0.081 'SIDE CHAIN' 45 16 TYR A 189 ? ? 0.066 'SIDE CHAIN' 46 17 ARG A 191 ? ? 0.082 'SIDE CHAIN' 47 17 TYR A 192 ? ? 0.073 'SIDE CHAIN' 48 18 TYR A 147 ? ? 0.088 'SIDE CHAIN' 49 18 TYR A 192 ? ? 0.067 'SIDE CHAIN' 50 19 TYR A 169 ? ? 0.114 'SIDE CHAIN' 51 19 TYR A 189 ? ? 0.064 'SIDE CHAIN' 52 20 PHE A 158 ? ? 0.078 'SIDE CHAIN' 53 20 TYR A 169 ? ? 0.092 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1RXR _pdbx_nmr_ensemble.conformers_calculated_total_number 83 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST RESTRAINT VIOLATIONS AND AMBER ENERGIES' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents WATER # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 'CBCA(CO)NH' 1 2 1 'HBHA(CBCACO)NH' 1 3 1 CBCANH 1 4 1 'C(CO)NH-TOCSY' 1 5 1 HCCH-COSY 1 6 1 HCCH-TOCSY 1 7 1 '13C-EDITED NOESY' 1 8 1 '15N-EDITED NOESY' 1 9 1 '15N-EDITED TOCSY' 1 10 1 HNHA 1 11 1 HNHB 1 12 1 HACAHB-COSY 1 13 1 13C-13CO 1 14 1 '13C-15N SPIN ECHO DIFFERENCE CT-HSQC' 1 # _pdbx_nmr_details.entry_id 1RXR _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELED RXR-DBD' # _pdbx_nmr_refine.entry_id 1RXR _pdbx_nmr_refine.method 'DISTANCE GEOMETRY AND RESTRAINED MOLECULAR DYNAMICS' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Amber ? 'PEARLMAN,CASE,CALDWELL,ROSS,CHEATHAM, FERGUSON,SEIBEL,SINGH,WEINER,KOLLMAN' 1 'structure solution' 'SYBYL TRIAD' TRIAD ? 2 'structure solution' DIANA ? ? 3 'structure solution' Amber ? ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TYR N N N N 301 TYR CA C N S 302 TYR C C N N 303 TYR O O N N 304 TYR CB C N N 305 TYR CG C Y N 306 TYR CD1 C Y N 307 TYR CD2 C Y N 308 TYR CE1 C Y N 309 TYR CE2 C Y N 310 TYR CZ C Y N 311 TYR OH O N N 312 TYR OXT O N N 313 TYR H H N N 314 TYR H2 H N N 315 TYR HA H N N 316 TYR HB2 H N N 317 TYR HB3 H N N 318 TYR HD1 H N N 319 TYR HD2 H N N 320 TYR HE1 H N N 321 TYR HE2 H N N 322 TYR HH H N N 323 TYR HXT H N N 324 VAL N N N N 325 VAL CA C N S 326 VAL C C N N 327 VAL O O N N 328 VAL CB C N N 329 VAL CG1 C N N 330 VAL CG2 C N N 331 VAL OXT O N N 332 VAL H H N N 333 VAL H2 H N N 334 VAL HA H N N 335 VAL HB H N N 336 VAL HG11 H N N 337 VAL HG12 H N N 338 VAL HG13 H N N 339 VAL HG21 H N N 340 VAL HG22 H N N 341 VAL HG23 H N N 342 VAL HXT H N N 343 ZN ZN ZN N N 344 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 THR N CA sing N N 271 THR N H sing N N 272 THR N H2 sing N N 273 THR CA C sing N N 274 THR CA CB sing N N 275 THR CA HA sing N N 276 THR C O doub N N 277 THR C OXT sing N N 278 THR CB OG1 sing N N 279 THR CB CG2 sing N N 280 THR CB HB sing N N 281 THR OG1 HG1 sing N N 282 THR CG2 HG21 sing N N 283 THR CG2 HG22 sing N N 284 THR CG2 HG23 sing N N 285 THR OXT HXT sing N N 286 TYR N CA sing N N 287 TYR N H sing N N 288 TYR N H2 sing N N 289 TYR CA C sing N N 290 TYR CA CB sing N N 291 TYR CA HA sing N N 292 TYR C O doub N N 293 TYR C OXT sing N N 294 TYR CB CG sing N N 295 TYR CB HB2 sing N N 296 TYR CB HB3 sing N N 297 TYR CG CD1 doub Y N 298 TYR CG CD2 sing Y N 299 TYR CD1 CE1 sing Y N 300 TYR CD1 HD1 sing N N 301 TYR CD2 CE2 doub Y N 302 TYR CD2 HD2 sing N N 303 TYR CE1 CZ doub Y N 304 TYR CE1 HE1 sing N N 305 TYR CE2 CZ sing Y N 306 TYR CE2 HE2 sing N N 307 TYR CZ OH sing N N 308 TYR OH HH sing N N 309 TYR OXT HXT sing N N 310 VAL N CA sing N N 311 VAL N H sing N N 312 VAL N H2 sing N N 313 VAL CA C sing N N 314 VAL CA CB sing N N 315 VAL CA HA sing N N 316 VAL C O doub N N 317 VAL C OXT sing N N 318 VAL CB CG1 sing N N 319 VAL CB CG2 sing N N 320 VAL CB HB sing N N 321 VAL CG1 HG11 sing N N 322 VAL CG1 HG12 sing N N 323 VAL CG1 HG13 sing N N 324 VAL CG2 HG21 sing N N 325 VAL CG2 HG22 sing N N 326 VAL CG2 HG23 sing N N 327 VAL OXT HXT sing N N 328 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 AMX Bruker 500 2 DMX Bruker 600 # _atom_sites.entry_id 1RXR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #