data_1RY3 # _entry.id 1RY3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RY3 pdb_00001ry3 10.2210/pdb1ry3/pdb RCSB RCSB021136 ? ? WWPDB D_1000021136 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-05-04 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RY3 _pdbx_database_status.recvd_initial_deposition_date 2003-12-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sprules, T.' 1 'Kawulka, K.E.' 2 'Gibbs, A.C.' 3 'Wishart, D.S.' 4 'Vederas, J.C.' 5 # _citation.id primary _citation.title 'NMR solution structure of the precursor for carnobacteriocin B2, an antimicrobial peptide from Carnobacterium piscicola.' _citation.journal_abbrev Eur.J.Biochem. _citation.journal_volume 271 _citation.page_first 1748 _citation.page_last 1756 _citation.year 2004 _citation.journal_id_ASTM EJBCAI _citation.country IX _citation.journal_id_ISSN 0014-2956 _citation.journal_id_CSD 0262 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15096213 _citation.pdbx_database_id_DOI 10.1111/j.1432-1033.2004.04085.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sprules, T.' 1 ? primary 'Kawulka, K.E.' 2 ? primary 'Gibbs, A.C.' 3 ? primary 'Wishart, D.S.' 4 ? primary 'Vederas, J.C.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Bacteriocin carnobacteriocin B2' _entity.formula_weight 6748.579 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Carnocin CP52' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MNSVKELNVKEMKQLHGGVNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGR _entity_poly.pdbx_seq_one_letter_code_can MNSVKELNVKEMKQLHGGVNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 SER n 1 4 VAL n 1 5 LYS n 1 6 GLU n 1 7 LEU n 1 8 ASN n 1 9 VAL n 1 10 LYS n 1 11 GLU n 1 12 MET n 1 13 LYS n 1 14 GLN n 1 15 LEU n 1 16 HIS n 1 17 GLY n 1 18 GLY n 1 19 VAL n 1 20 ASN n 1 21 TYR n 1 22 GLY n 1 23 ASN n 1 24 GLY n 1 25 VAL n 1 26 SER n 1 27 CYS n 1 28 SER n 1 29 LYS n 1 30 THR n 1 31 LYS n 1 32 CYS n 1 33 SER n 1 34 VAL n 1 35 ASN n 1 36 TRP n 1 37 GLY n 1 38 GLN n 1 39 ALA n 1 40 PHE n 1 41 GLN n 1 42 GLU n 1 43 ARG n 1 44 TYR n 1 45 THR n 1 46 ALA n 1 47 GLY n 1 48 ILE n 1 49 ASN n 1 50 SER n 1 51 PHE n 1 52 VAL n 1 53 SER n 1 54 GLY n 1 55 VAL n 1 56 ALA n 1 57 SER n 1 58 GLY n 1 59 ALA n 1 60 GLY n 1 61 SER n 1 62 ILE n 1 63 GLY n 1 64 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Carnobacterium _entity_src_gen.pdbx_gene_src_gene 'CBNB2, CANCP52' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain LV17B _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Carnobacterium maltaromaticum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2751 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMAl-c _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -18 -18 MET MET A . n A 1 2 ASN 2 -17 -17 ASN ASN A . n A 1 3 SER 3 -16 -16 SER SER A . n A 1 4 VAL 4 -15 -15 VAL VAL A . n A 1 5 LYS 5 -14 -14 LYS LYS A . n A 1 6 GLU 6 -13 -13 GLU GLU A . n A 1 7 LEU 7 -12 -12 LEU LEU A . n A 1 8 ASN 8 -11 -11 ASN ASN A . n A 1 9 VAL 9 -10 -10 VAL VAL A . n A 1 10 LYS 10 -9 -9 LYS LYS A . n A 1 11 GLU 11 -8 -8 GLU GLU A . n A 1 12 MET 12 -7 -7 MET MET A . n A 1 13 LYS 13 -6 -6 LYS LYS A . n A 1 14 GLN 14 -5 -5 GLN GLN A . n A 1 15 LEU 15 -4 -4 LEU LEU A . n A 1 16 HIS 16 -3 -3 HIS HIS A . n A 1 17 GLY 17 -2 -2 GLY GLY A . n A 1 18 GLY 18 -1 -1 GLY GLY A . n A 1 19 VAL 19 1 1 VAL VAL A . n A 1 20 ASN 20 2 2 ASN ASN A . n A 1 21 TYR 21 3 3 TYR TYR A . n A 1 22 GLY 22 4 4 GLY GLY A . n A 1 23 ASN 23 5 5 ASN ASN A . n A 1 24 GLY 24 6 6 GLY GLY A . n A 1 25 VAL 25 7 7 VAL VAL A . n A 1 26 SER 26 8 8 SER SER A . n A 1 27 CYS 27 9 9 CYS CYS A . n A 1 28 SER 28 10 10 SER SER A . n A 1 29 LYS 29 11 11 LYS LYS A . n A 1 30 THR 30 12 12 THR THR A . n A 1 31 LYS 31 13 13 LYS LYS A . n A 1 32 CYS 32 14 14 CYS CYS A . n A 1 33 SER 33 15 15 SER SER A . n A 1 34 VAL 34 16 16 VAL VAL A . n A 1 35 ASN 35 17 17 ASN ASN A . n A 1 36 TRP 36 18 18 TRP TRP A . n A 1 37 GLY 37 19 19 GLY GLY A . n A 1 38 GLN 38 20 20 GLN GLN A . n A 1 39 ALA 39 21 21 ALA ALA A . n A 1 40 PHE 40 22 22 PHE PHE A . n A 1 41 GLN 41 23 23 GLN GLN A . n A 1 42 GLU 42 24 24 GLU GLU A . n A 1 43 ARG 43 25 25 ARG ARG A . n A 1 44 TYR 44 26 26 TYR TYR A . n A 1 45 THR 45 27 27 THR THR A . n A 1 46 ALA 46 28 28 ALA ALA A . n A 1 47 GLY 47 29 29 GLY GLY A . n A 1 48 ILE 48 30 30 ILE ILE A . n A 1 49 ASN 49 31 31 ASN ASN A . n A 1 50 SER 50 32 32 SER SER A . n A 1 51 PHE 51 33 33 PHE PHE A . n A 1 52 VAL 52 34 34 VAL VAL A . n A 1 53 SER 53 35 35 SER SER A . n A 1 54 GLY 54 36 36 GLY GLY A . n A 1 55 VAL 55 37 37 VAL VAL A . n A 1 56 ALA 56 38 38 ALA ALA A . n A 1 57 SER 57 39 39 SER SER A . n A 1 58 GLY 58 40 40 GLY GLY A . n A 1 59 ALA 59 41 41 ALA ALA A . n A 1 60 GLY 60 42 42 GLY GLY A . n A 1 61 SER 61 43 43 SER SER A . n A 1 62 ILE 62 44 44 ILE ILE A . n A 1 63 GLY 63 45 45 GLY GLY A . n A 1 64 ARG 64 46 46 ARG ARG A . n # _cell.entry_id 1RY3 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RY3 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1RY3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1RY3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1RY3 _struct.title 'NMR Solution Structure of the Precursor for Carnobacteriocin B2, an Antimicrobial Peptide from Carnobacterium piscicola' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RY3 _struct_keywords.pdbx_keywords ANTIBIOTIC _struct_keywords.text 'amphipathic helix, ANTIBIOTIC' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBB2_CARPI _struct_ref.pdbx_db_accession P38580 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MNSVKELNVKEMKQLHGGVNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGR _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RY3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38580 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 64 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -18 _struct_ref_seq.pdbx_auth_seq_align_end 45 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? GLN A 14 ? SER A -16 GLN A -5 1 ? 12 HELX_P HELX_P2 2 GLY A 37 ? ALA A 56 ? GLY A 19 ALA A 38 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 27 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 32 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 9 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 14 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.030 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 27 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 32 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 9 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 14 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _pdbx_entry_details.entry_id 1RY3 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A VAL 34 ? ? H A ALA 38 ? ? 1.60 2 9 O A VAL 34 ? ? H A ALA 38 ? ? 1.54 3 10 O A VAL 34 ? ? H A ALA 38 ? ? 1.56 4 11 O A VAL 34 ? ? H A ALA 38 ? ? 1.56 5 14 O A VAL 34 ? ? H A ALA 38 ? ? 1.53 6 18 O A VAL 34 ? ? H A ALA 38 ? ? 1.56 7 19 O A VAL 34 ? ? H A ALA 38 ? ? 1.51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 3 ? ? 63.22 68.01 2 1 SER A 10 ? ? -160.93 111.33 3 1 LYS A 11 ? ? 65.28 -14.67 4 1 CYS A 14 ? ? -104.14 50.29 5 1 ASN A 17 ? ? -106.72 62.29 6 1 VAL A 34 ? ? -54.70 -74.92 7 1 VAL A 37 ? ? -91.29 -71.58 8 1 ALA A 38 ? ? -83.42 -75.15 9 1 SER A 39 ? ? -62.73 5.11 10 2 ASN A 2 ? ? -161.92 37.59 11 2 TYR A 3 ? ? -177.90 39.68 12 2 SER A 8 ? ? 51.99 -179.97 13 2 SER A 10 ? ? -168.57 108.67 14 2 LYS A 11 ? ? 62.96 -8.50 15 2 CYS A 14 ? ? -98.16 50.94 16 2 VAL A 34 ? ? -54.66 -74.50 17 2 VAL A 37 ? ? -91.43 -72.56 18 2 ALA A 38 ? ? -83.41 -75.24 19 2 SER A 39 ? ? -62.78 6.47 20 2 SER A 43 ? ? -109.17 58.79 21 3 LEU A -4 ? ? -90.43 -71.99 22 3 VAL A 1 ? ? 44.97 -169.41 23 3 VAL A 7 ? ? -101.57 -160.75 24 3 LYS A 13 ? ? -52.06 178.69 25 3 CYS A 14 ? ? -94.88 33.50 26 3 SER A 15 ? ? -161.92 78.09 27 3 ASN A 17 ? ? 179.71 39.55 28 3 VAL A 34 ? ? -54.78 -73.98 29 3 VAL A 37 ? ? -91.47 -70.54 30 3 ALA A 38 ? ? -83.47 -75.10 31 3 SER A 39 ? ? -63.91 9.34 32 3 ILE A 44 ? ? -163.84 51.60 33 4 GLU A -8 ? ? -55.55 -74.30 34 4 LEU A -4 ? ? -90.17 -71.84 35 4 ASN A 2 ? ? -152.39 59.08 36 4 TYR A 3 ? ? 60.26 79.82 37 4 VAL A 7 ? ? 41.09 -161.63 38 4 CYS A 9 ? ? -48.64 173.88 39 4 SER A 10 ? ? -166.82 111.08 40 4 CYS A 14 ? ? -99.96 37.24 41 4 ASN A 17 ? ? -179.37 98.04 42 4 VAL A 34 ? ? -54.78 -70.62 43 4 VAL A 37 ? ? -91.41 -70.88 44 4 ALA A 38 ? ? -83.31 -75.26 45 4 SER A 39 ? ? -63.20 6.76 46 4 ALA A 41 ? ? -163.13 -82.91 47 4 SER A 43 ? ? -94.35 45.61 48 5 GLU A -8 ? ? -60.76 -70.69 49 5 VAL A 1 ? ? -58.43 100.34 50 5 ASN A 2 ? ? -159.74 38.58 51 5 TYR A 3 ? ? -176.69 38.60 52 5 ASN A 5 ? ? -53.72 -87.52 53 5 LYS A 11 ? ? -160.09 -35.44 54 5 LYS A 13 ? ? -30.25 121.87 55 5 CYS A 14 ? ? -90.88 39.54 56 5 VAL A 16 ? ? -93.70 49.18 57 5 ASN A 17 ? ? 70.96 98.50 58 5 VAL A 34 ? ? -54.68 -74.29 59 5 VAL A 37 ? ? -91.35 -71.09 60 5 ALA A 38 ? ? -83.34 -74.82 61 5 SER A 39 ? ? -65.27 12.75 62 5 ALA A 41 ? ? -163.46 -83.35 63 5 SER A 43 ? ? -158.37 -38.66 64 5 ILE A 44 ? ? 52.25 74.79 65 6 GLU A -8 ? ? -58.38 -80.53 66 6 VAL A 7 ? ? 41.25 -162.04 67 6 SER A 10 ? ? -178.87 113.79 68 6 THR A 12 ? ? -149.80 -7.55 69 6 CYS A 14 ? ? 67.84 96.40 70 6 VAL A 16 ? ? -96.17 41.00 71 6 VAL A 34 ? ? -54.70 -71.86 72 6 VAL A 37 ? ? -91.46 -72.18 73 6 ALA A 38 ? ? -83.43 -75.36 74 6 SER A 39 ? ? -62.98 7.31 75 6 ALA A 41 ? ? -168.07 54.82 76 6 SER A 43 ? ? -103.67 60.05 77 7 GLU A -8 ? ? -54.98 -72.66 78 7 TYR A 3 ? ? 60.77 79.06 79 7 SER A 8 ? ? 54.82 173.03 80 7 SER A 10 ? ? -160.51 112.31 81 7 CYS A 14 ? ? -98.41 30.92 82 7 SER A 15 ? ? -155.89 38.89 83 7 ASN A 17 ? ? -97.14 38.54 84 7 VAL A 34 ? ? -54.74 -74.76 85 7 VAL A 37 ? ? -91.47 -71.97 86 7 ALA A 38 ? ? -83.34 -75.43 87 7 SER A 39 ? ? -63.43 9.20 88 7 ILE A 44 ? ? -107.65 40.61 89 8 ASN A -17 ? ? -90.36 45.57 90 8 GLU A -8 ? ? -58.94 -70.86 91 8 LEU A -4 ? ? -90.19 -72.99 92 8 ASN A 2 ? ? -161.73 39.76 93 8 TYR A 3 ? ? -178.22 39.24 94 8 SER A 10 ? ? -162.61 110.02 95 8 LYS A 11 ? ? 59.65 2.78 96 8 VAL A 16 ? ? 28.18 100.08 97 8 VAL A 34 ? ? -54.56 -73.36 98 8 VAL A 37 ? ? -91.13 -71.57 99 8 ALA A 38 ? ? -83.52 -74.83 100 8 SER A 39 ? ? -62.55 3.19 101 8 ALA A 41 ? ? -168.55 -81.08 102 8 SER A 43 ? ? -154.57 31.44 103 9 LEU A -4 ? ? -90.48 -67.54 104 9 TYR A 3 ? ? 60.45 78.55 105 9 VAL A 7 ? ? -59.56 -161.70 106 9 SER A 8 ? ? -67.75 -165.05 107 9 CYS A 9 ? ? 50.88 -153.04 108 9 LYS A 11 ? ? -149.96 -40.46 109 9 THR A 12 ? ? -151.01 -154.31 110 9 SER A 15 ? ? -161.84 72.97 111 9 ASN A 17 ? ? -176.57 95.80 112 9 VAL A 34 ? ? -54.72 -71.82 113 9 VAL A 37 ? ? -91.42 -69.11 114 9 ALA A 38 ? ? -83.53 -74.96 115 9 SER A 39 ? ? -62.55 4.76 116 9 ILE A 44 ? ? 46.41 71.46 117 10 ASN A 2 ? ? -161.76 87.74 118 10 TYR A 3 ? ? 61.15 -142.23 119 10 ASN A 5 ? ? -156.51 -43.42 120 10 VAL A 7 ? ? 41.10 -161.66 121 10 VAL A 34 ? ? -54.68 -73.76 122 10 VAL A 37 ? ? -91.51 -69.70 123 10 ALA A 38 ? ? -83.40 -74.90 124 10 SER A 39 ? ? -62.66 3.94 125 10 ALA A 41 ? ? -62.00 -87.12 126 10 SER A 43 ? ? 49.09 27.54 127 11 GLU A -8 ? ? -55.84 -77.58 128 11 VAL A 1 ? ? -45.91 159.89 129 11 TYR A 3 ? ? 63.99 71.97 130 11 LYS A 11 ? ? 59.81 1.40 131 11 LYS A 13 ? ? -57.76 175.50 132 11 VAL A 37 ? ? -91.50 -69.26 133 11 ALA A 38 ? ? -83.28 -74.83 134 11 SER A 39 ? ? -65.10 12.66 135 11 ALA A 41 ? ? -169.76 34.09 136 12 ASN A 2 ? ? -152.46 63.71 137 12 VAL A 7 ? ? 41.08 -162.50 138 12 SER A 8 ? ? -107.75 -159.21 139 12 CYS A 9 ? ? 36.22 108.69 140 12 LYS A 13 ? ? -47.24 170.37 141 12 VAL A 34 ? ? -54.68 -73.28 142 12 VAL A 37 ? ? -91.48 -72.35 143 12 ALA A 38 ? ? -83.37 -75.03 144 12 SER A 39 ? ? -63.20 7.27 145 12 SER A 43 ? ? -58.71 -80.94 146 13 GLU A -8 ? ? -50.75 -74.10 147 13 GLN A -5 ? ? -66.99 -135.96 148 13 VAL A 1 ? ? 178.97 111.90 149 13 ASN A 2 ? ? -161.85 82.41 150 13 TYR A 3 ? ? 58.86 80.26 151 13 VAL A 7 ? ? -58.80 -162.00 152 13 CYS A 14 ? ? -98.89 53.39 153 13 VAL A 16 ? ? -96.44 41.29 154 13 ASN A 17 ? ? 61.25 69.96 155 13 VAL A 34 ? ? -54.73 -75.70 156 13 VAL A 37 ? ? -91.29 -71.53 157 13 ALA A 38 ? ? -83.34 -74.89 158 13 SER A 39 ? ? -62.55 4.37 159 13 ALA A 41 ? ? -171.94 -39.84 160 13 ILE A 44 ? ? -168.63 44.49 161 14 GLU A -8 ? ? -58.03 -73.18 162 14 ASN A 5 ? ? -90.18 -69.27 163 14 SER A 10 ? ? -162.36 114.09 164 14 THR A 12 ? ? -150.82 2.79 165 14 VAL A 16 ? ? -61.36 -164.11 166 14 VAL A 34 ? ? -58.16 -75.11 167 14 VAL A 37 ? ? -91.96 -60.59 168 14 ALA A 38 ? ? -82.90 -73.45 169 14 ALA A 41 ? ? -164.11 42.61 170 14 SER A 43 ? ? -151.34 31.30 171 14 ILE A 44 ? ? -118.90 52.29 172 15 ASN A -17 ? ? -90.41 44.63 173 15 GLU A -8 ? ? -60.21 -78.93 174 15 ASN A 2 ? ? -161.75 69.92 175 15 VAL A 7 ? ? 40.74 -161.42 176 15 SER A 10 ? ? -168.02 111.18 177 15 LYS A 11 ? ? 59.10 2.89 178 15 LYS A 13 ? ? -53.86 -175.73 179 15 CYS A 14 ? ? -117.61 -136.28 180 15 ASN A 17 ? ? -96.07 57.70 181 15 VAL A 34 ? ? -54.60 -72.32 182 15 VAL A 37 ? ? -91.35 -70.96 183 15 ALA A 38 ? ? -83.29 -75.04 184 15 SER A 39 ? ? -62.66 5.10 185 16 GLU A -8 ? ? -59.91 -78.98 186 16 ASN A 2 ? ? -140.67 41.38 187 16 VAL A 7 ? ? -75.12 -161.41 188 16 LYS A 13 ? ? -67.69 -164.95 189 16 CYS A 14 ? ? -124.67 -136.24 190 16 VAL A 34 ? ? -54.63 -73.70 191 16 VAL A 37 ? ? -91.35 -71.41 192 16 ALA A 38 ? ? -83.48 -74.90 193 16 SER A 39 ? ? -62.58 3.72 194 17 ASN A 2 ? ? -152.97 40.22 195 17 TYR A 3 ? ? 60.56 77.70 196 17 VAL A 7 ? ? -75.27 -160.53 197 17 SER A 8 ? ? 54.00 174.02 198 17 SER A 10 ? ? -172.03 109.38 199 17 LYS A 11 ? ? 58.47 3.31 200 17 LYS A 13 ? ? -53.43 -176.57 201 17 CYS A 14 ? ? -117.45 -136.38 202 17 ASN A 17 ? ? -95.79 41.99 203 17 VAL A 34 ? ? -54.66 -74.61 204 17 VAL A 37 ? ? -91.43 -70.99 205 17 ALA A 38 ? ? -83.38 -74.62 206 17 SER A 39 ? ? -62.53 3.31 207 17 SER A 43 ? ? -106.20 -81.72 208 17 ILE A 44 ? ? -163.31 89.88 209 18 LEU A -4 ? ? -90.45 -68.10 210 18 TYR A 3 ? ? 61.20 79.80 211 18 SER A 10 ? ? -168.39 112.63 212 18 THR A 12 ? ? -151.35 30.17 213 18 LYS A 13 ? ? 50.18 -160.95 214 18 CYS A 14 ? ? -108.62 -136.07 215 18 VAL A 37 ? ? -91.86 -67.53 216 18 ALA A 38 ? ? -83.41 -74.98 217 18 SER A 39 ? ? -62.59 5.17 218 19 GLU A -8 ? ? -55.84 -78.06 219 19 TYR A 3 ? ? 43.29 80.12 220 19 LYS A 11 ? ? 59.34 4.30 221 19 LYS A 13 ? ? -54.97 -170.13 222 19 CYS A 14 ? ? -112.74 -136.25 223 19 ASN A 17 ? ? -93.25 42.78 224 19 VAL A 34 ? ? -59.92 -75.85 225 19 ALA A 38 ? ? -82.80 -74.35 226 19 SER A 39 ? ? -62.52 1.61 227 19 ILE A 44 ? ? -163.35 70.16 228 20 ASN A 2 ? ? -158.79 69.26 229 20 VAL A 7 ? ? 41.25 -161.82 230 20 SER A 10 ? ? -156.48 19.10 231 20 LYS A 11 ? ? -162.05 -31.40 232 20 LYS A 13 ? ? -69.27 28.89 233 20 CYS A 14 ? ? 74.78 67.67 234 20 SER A 15 ? ? -161.83 90.61 235 20 VAL A 34 ? ? -54.66 -73.99 236 20 VAL A 37 ? ? -91.40 -71.33 237 20 ALA A 38 ? ? -83.33 -74.99 238 20 SER A 39 ? ? -63.31 7.71 239 20 ALA A 41 ? ? -146.06 -44.01 240 20 ILE A 44 ? ? -103.11 59.50 # _pdbx_nmr_ensemble.entry_id 1RY3 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RY3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM precarnobacteriocin B2 U-15N' '70% TFE-d3, 30% H2O' 2 '1 mM precarnobacteriocin B2 U-15N,U-13C' '70% TFE-d3, 30% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 2 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 HNHA 3 2 1 3D_13C-separated_NOESY # _pdbx_nmr_refine.entry_id 1RY3 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details '649 NOE-derived distance constraints, 22 hydrogen bonds and 91 dihedral angles were used in the calculation' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1C collection ? 1 NMRPipe 2.2 processing 'Delaglio, F., Grzesiek, S., Vuister, G.W., Zhu, G.' 2 NMRView 5.0 'data analysis' 'Johnson, B.A., Blevins, R.A.J.' 3 CNS 1.1 'structure solution' ? 4 CNS 1.1 refinement ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 ILE N N N N 142 ILE CA C N S 143 ILE C C N N 144 ILE O O N N 145 ILE CB C N S 146 ILE CG1 C N N 147 ILE CG2 C N N 148 ILE CD1 C N N 149 ILE OXT O N N 150 ILE H H N N 151 ILE H2 H N N 152 ILE HA H N N 153 ILE HB H N N 154 ILE HG12 H N N 155 ILE HG13 H N N 156 ILE HG21 H N N 157 ILE HG22 H N N 158 ILE HG23 H N N 159 ILE HD11 H N N 160 ILE HD12 H N N 161 ILE HD13 H N N 162 ILE HXT H N N 163 LEU N N N N 164 LEU CA C N S 165 LEU C C N N 166 LEU O O N N 167 LEU CB C N N 168 LEU CG C N N 169 LEU CD1 C N N 170 LEU CD2 C N N 171 LEU OXT O N N 172 LEU H H N N 173 LEU H2 H N N 174 LEU HA H N N 175 LEU HB2 H N N 176 LEU HB3 H N N 177 LEU HG H N N 178 LEU HD11 H N N 179 LEU HD12 H N N 180 LEU HD13 H N N 181 LEU HD21 H N N 182 LEU HD22 H N N 183 LEU HD23 H N N 184 LEU HXT H N N 185 LYS N N N N 186 LYS CA C N S 187 LYS C C N N 188 LYS O O N N 189 LYS CB C N N 190 LYS CG C N N 191 LYS CD C N N 192 LYS CE C N N 193 LYS NZ N N N 194 LYS OXT O N N 195 LYS H H N N 196 LYS H2 H N N 197 LYS HA H N N 198 LYS HB2 H N N 199 LYS HB3 H N N 200 LYS HG2 H N N 201 LYS HG3 H N N 202 LYS HD2 H N N 203 LYS HD3 H N N 204 LYS HE2 H N N 205 LYS HE3 H N N 206 LYS HZ1 H N N 207 LYS HZ2 H N N 208 LYS HZ3 H N N 209 LYS HXT H N N 210 MET N N N N 211 MET CA C N S 212 MET C C N N 213 MET O O N N 214 MET CB C N N 215 MET CG C N N 216 MET SD S N N 217 MET CE C N N 218 MET OXT O N N 219 MET H H N N 220 MET H2 H N N 221 MET HA H N N 222 MET HB2 H N N 223 MET HB3 H N N 224 MET HG2 H N N 225 MET HG3 H N N 226 MET HE1 H N N 227 MET HE2 H N N 228 MET HE3 H N N 229 MET HXT H N N 230 PHE N N N N 231 PHE CA C N S 232 PHE C C N N 233 PHE O O N N 234 PHE CB C N N 235 PHE CG C Y N 236 PHE CD1 C Y N 237 PHE CD2 C Y N 238 PHE CE1 C Y N 239 PHE CE2 C Y N 240 PHE CZ C Y N 241 PHE OXT O N N 242 PHE H H N N 243 PHE H2 H N N 244 PHE HA H N N 245 PHE HB2 H N N 246 PHE HB3 H N N 247 PHE HD1 H N N 248 PHE HD2 H N N 249 PHE HE1 H N N 250 PHE HE2 H N N 251 PHE HZ H N N 252 PHE HXT H N N 253 SER N N N N 254 SER CA C N S 255 SER C C N N 256 SER O O N N 257 SER CB C N N 258 SER OG O N N 259 SER OXT O N N 260 SER H H N N 261 SER H2 H N N 262 SER HA H N N 263 SER HB2 H N N 264 SER HB3 H N N 265 SER HG H N N 266 SER HXT H N N 267 THR N N N N 268 THR CA C N S 269 THR C C N N 270 THR O O N N 271 THR CB C N R 272 THR OG1 O N N 273 THR CG2 C N N 274 THR OXT O N N 275 THR H H N N 276 THR H2 H N N 277 THR HA H N N 278 THR HB H N N 279 THR HG1 H N N 280 THR HG21 H N N 281 THR HG22 H N N 282 THR HG23 H N N 283 THR HXT H N N 284 TRP N N N N 285 TRP CA C N S 286 TRP C C N N 287 TRP O O N N 288 TRP CB C N N 289 TRP CG C Y N 290 TRP CD1 C Y N 291 TRP CD2 C Y N 292 TRP NE1 N Y N 293 TRP CE2 C Y N 294 TRP CE3 C Y N 295 TRP CZ2 C Y N 296 TRP CZ3 C Y N 297 TRP CH2 C Y N 298 TRP OXT O N N 299 TRP H H N N 300 TRP H2 H N N 301 TRP HA H N N 302 TRP HB2 H N N 303 TRP HB3 H N N 304 TRP HD1 H N N 305 TRP HE1 H N N 306 TRP HE3 H N N 307 TRP HZ2 H N N 308 TRP HZ3 H N N 309 TRP HH2 H N N 310 TRP HXT H N N 311 TYR N N N N 312 TYR CA C N S 313 TYR C C N N 314 TYR O O N N 315 TYR CB C N N 316 TYR CG C Y N 317 TYR CD1 C Y N 318 TYR CD2 C Y N 319 TYR CE1 C Y N 320 TYR CE2 C Y N 321 TYR CZ C Y N 322 TYR OH O N N 323 TYR OXT O N N 324 TYR H H N N 325 TYR H2 H N N 326 TYR HA H N N 327 TYR HB2 H N N 328 TYR HB3 H N N 329 TYR HD1 H N N 330 TYR HD2 H N N 331 TYR HE1 H N N 332 TYR HE2 H N N 333 TYR HH H N N 334 TYR HXT H N N 335 VAL N N N N 336 VAL CA C N S 337 VAL C C N N 338 VAL O O N N 339 VAL CB C N N 340 VAL CG1 C N N 341 VAL CG2 C N N 342 VAL OXT O N N 343 VAL H H N N 344 VAL H2 H N N 345 VAL HA H N N 346 VAL HB H N N 347 VAL HG11 H N N 348 VAL HG12 H N N 349 VAL HG13 H N N 350 VAL HG21 H N N 351 VAL HG22 H N N 352 VAL HG23 H N N 353 VAL HXT H N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 ILE N CA sing N N 135 ILE N H sing N N 136 ILE N H2 sing N N 137 ILE CA C sing N N 138 ILE CA CB sing N N 139 ILE CA HA sing N N 140 ILE C O doub N N 141 ILE C OXT sing N N 142 ILE CB CG1 sing N N 143 ILE CB CG2 sing N N 144 ILE CB HB sing N N 145 ILE CG1 CD1 sing N N 146 ILE CG1 HG12 sing N N 147 ILE CG1 HG13 sing N N 148 ILE CG2 HG21 sing N N 149 ILE CG2 HG22 sing N N 150 ILE CG2 HG23 sing N N 151 ILE CD1 HD11 sing N N 152 ILE CD1 HD12 sing N N 153 ILE CD1 HD13 sing N N 154 ILE OXT HXT sing N N 155 LEU N CA sing N N 156 LEU N H sing N N 157 LEU N H2 sing N N 158 LEU CA C sing N N 159 LEU CA CB sing N N 160 LEU CA HA sing N N 161 LEU C O doub N N 162 LEU C OXT sing N N 163 LEU CB CG sing N N 164 LEU CB HB2 sing N N 165 LEU CB HB3 sing N N 166 LEU CG CD1 sing N N 167 LEU CG CD2 sing N N 168 LEU CG HG sing N N 169 LEU CD1 HD11 sing N N 170 LEU CD1 HD12 sing N N 171 LEU CD1 HD13 sing N N 172 LEU CD2 HD21 sing N N 173 LEU CD2 HD22 sing N N 174 LEU CD2 HD23 sing N N 175 LEU OXT HXT sing N N 176 LYS N CA sing N N 177 LYS N H sing N N 178 LYS N H2 sing N N 179 LYS CA C sing N N 180 LYS CA CB sing N N 181 LYS CA HA sing N N 182 LYS C O doub N N 183 LYS C OXT sing N N 184 LYS CB CG sing N N 185 LYS CB HB2 sing N N 186 LYS CB HB3 sing N N 187 LYS CG CD sing N N 188 LYS CG HG2 sing N N 189 LYS CG HG3 sing N N 190 LYS CD CE sing N N 191 LYS CD HD2 sing N N 192 LYS CD HD3 sing N N 193 LYS CE NZ sing N N 194 LYS CE HE2 sing N N 195 LYS CE HE3 sing N N 196 LYS NZ HZ1 sing N N 197 LYS NZ HZ2 sing N N 198 LYS NZ HZ3 sing N N 199 LYS OXT HXT sing N N 200 MET N CA sing N N 201 MET N H sing N N 202 MET N H2 sing N N 203 MET CA C sing N N 204 MET CA CB sing N N 205 MET CA HA sing N N 206 MET C O doub N N 207 MET C OXT sing N N 208 MET CB CG sing N N 209 MET CB HB2 sing N N 210 MET CB HB3 sing N N 211 MET CG SD sing N N 212 MET CG HG2 sing N N 213 MET CG HG3 sing N N 214 MET SD CE sing N N 215 MET CE HE1 sing N N 216 MET CE HE2 sing N N 217 MET CE HE3 sing N N 218 MET OXT HXT sing N N 219 PHE N CA sing N N 220 PHE N H sing N N 221 PHE N H2 sing N N 222 PHE CA C sing N N 223 PHE CA CB sing N N 224 PHE CA HA sing N N 225 PHE C O doub N N 226 PHE C OXT sing N N 227 PHE CB CG sing N N 228 PHE CB HB2 sing N N 229 PHE CB HB3 sing N N 230 PHE CG CD1 doub Y N 231 PHE CG CD2 sing Y N 232 PHE CD1 CE1 sing Y N 233 PHE CD1 HD1 sing N N 234 PHE CD2 CE2 doub Y N 235 PHE CD2 HD2 sing N N 236 PHE CE1 CZ doub Y N 237 PHE CE1 HE1 sing N N 238 PHE CE2 CZ sing Y N 239 PHE CE2 HE2 sing N N 240 PHE CZ HZ sing N N 241 PHE OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TRP N CA sing N N 272 TRP N H sing N N 273 TRP N H2 sing N N 274 TRP CA C sing N N 275 TRP CA CB sing N N 276 TRP CA HA sing N N 277 TRP C O doub N N 278 TRP C OXT sing N N 279 TRP CB CG sing N N 280 TRP CB HB2 sing N N 281 TRP CB HB3 sing N N 282 TRP CG CD1 doub Y N 283 TRP CG CD2 sing Y N 284 TRP CD1 NE1 sing Y N 285 TRP CD1 HD1 sing N N 286 TRP CD2 CE2 doub Y N 287 TRP CD2 CE3 sing Y N 288 TRP NE1 CE2 sing Y N 289 TRP NE1 HE1 sing N N 290 TRP CE2 CZ2 sing Y N 291 TRP CE3 CZ3 doub Y N 292 TRP CE3 HE3 sing N N 293 TRP CZ2 CH2 doub Y N 294 TRP CZ2 HZ2 sing N N 295 TRP CZ3 CH2 sing Y N 296 TRP CZ3 HZ3 sing N N 297 TRP CH2 HH2 sing N N 298 TRP OXT HXT sing N N 299 TYR N CA sing N N 300 TYR N H sing N N 301 TYR N H2 sing N N 302 TYR CA C sing N N 303 TYR CA CB sing N N 304 TYR CA HA sing N N 305 TYR C O doub N N 306 TYR C OXT sing N N 307 TYR CB CG sing N N 308 TYR CB HB2 sing N N 309 TYR CB HB3 sing N N 310 TYR CG CD1 doub Y N 311 TYR CG CD2 sing Y N 312 TYR CD1 CE1 sing Y N 313 TYR CD1 HD1 sing N N 314 TYR CD2 CE2 doub Y N 315 TYR CD2 HD2 sing N N 316 TYR CE1 CZ doub Y N 317 TYR CE1 HE1 sing N N 318 TYR CE2 CZ sing Y N 319 TYR CE2 HE2 sing N N 320 TYR CZ OH sing N N 321 TYR OH HH sing N N 322 TYR OXT HXT sing N N 323 VAL N CA sing N N 324 VAL N H sing N N 325 VAL N H2 sing N N 326 VAL CA C sing N N 327 VAL CA CB sing N N 328 VAL CA HA sing N N 329 VAL C O doub N N 330 VAL C OXT sing N N 331 VAL CB CG1 sing N N 332 VAL CB CG2 sing N N 333 VAL CB HB sing N N 334 VAL CG1 HG11 sing N N 335 VAL CG1 HG12 sing N N 336 VAL CG1 HG13 sing N N 337 VAL CG2 HG21 sing N N 338 VAL CG2 HG22 sing N N 339 VAL CG2 HG23 sing N N 340 VAL OXT HXT sing N N 341 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1RY3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_