data_1RYK # _entry.id 1RYK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RYK pdb_00001ryk 10.2210/pdb1ryk/pdb RCSB RCSB021152 ? ? WWPDB D_1000021152 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-02-24 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2004-02-24 _pdbx_database_PDB_obs_spr.pdb_id 1RYK _pdbx_database_PDB_obs_spr.replace_pdb_id 1JYG _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RYK _pdbx_database_status.recvd_initial_deposition_date 2003-12-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_mr REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 5105 . unspecified PDB 1JYG . unspecified TargetDB ET93 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pineda-Lucena, A.' 1 'Liao, J.' 2 'Wu, B.' 3 'Yee, A.' 4 'Cort, J.R.' 5 'Kennedy, M.A.' 6 'Edwards, A.M.' 7 'Arrowsmith, C.H.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 # _citation.id primary _citation.title 'An NMR approach to structural proteomics.' _citation.journal_abbrev Proteins _citation.journal_volume 47 _citation.page_first 572 _citation.page_last 574 _citation.year 2002 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11854485 _citation.pdbx_database_id_DOI 10.1002/prot.10120.abs # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pineda-Lucena, A.' 1 ? primary 'Liao, J.' 2 ? primary 'Wu, B.' 3 ? primary 'Yee, A.' 4 ? primary 'Cort, J.R.' 5 ? primary 'Kennedy, M.A.' 6 ? primary 'Edwards, A.M.' 7 ? primary 'Arrowsmith, C.H.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein yjbJ' _entity.formula_weight 8339.261 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MNKDEAGGNWKQFKGKVKEQWGKLTDDDMTIIEGKRDQLVGKIQERYGYQKDQAEKEVVDWETRNEYRW _entity_poly.pdbx_seq_one_letter_code_can MNKDEAGGNWKQFKGKVKEQWGKLTDDDMTIIEGKRDQLVGKIQERYGYQKDQAEKEVVDWETRNEYRW _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ET93 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LYS n 1 4 ASP n 1 5 GLU n 1 6 ALA n 1 7 GLY n 1 8 GLY n 1 9 ASN n 1 10 TRP n 1 11 LYS n 1 12 GLN n 1 13 PHE n 1 14 LYS n 1 15 GLY n 1 16 LYS n 1 17 VAL n 1 18 LYS n 1 19 GLU n 1 20 GLN n 1 21 TRP n 1 22 GLY n 1 23 LYS n 1 24 LEU n 1 25 THR n 1 26 ASP n 1 27 ASP n 1 28 ASP n 1 29 MET n 1 30 THR n 1 31 ILE n 1 32 ILE n 1 33 GLU n 1 34 GLY n 1 35 LYS n 1 36 ARG n 1 37 ASP n 1 38 GLN n 1 39 LEU n 1 40 VAL n 1 41 GLY n 1 42 LYS n 1 43 ILE n 1 44 GLN n 1 45 GLU n 1 46 ARG n 1 47 TYR n 1 48 GLY n 1 49 TYR n 1 50 GLN n 1 51 LYS n 1 52 ASP n 1 53 GLN n 1 54 ALA n 1 55 GLU n 1 56 LYS n 1 57 GLU n 1 58 VAL n 1 59 VAL n 1 60 ASP n 1 61 TRP n 1 62 GLU n 1 63 THR n 1 64 ARG n 1 65 ASN n 1 66 GLU n 1 67 TYR n 1 68 ARG n 1 69 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene 'YJBJ, B4045, Z5644, ECS5028, SF4160, S3571' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 TRP 69 69 69 TRP TRP A . n # _exptl.entry_id 1RYK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1RYK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1RYK _struct.title ;Solution NMR Structure Protein yjbJ from Escherichia coli. Northeast Structural Genomics Consortium Target ET93; Ontario Centre for Structural Proteomics target EC0298_1_69; ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RYK _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;Alpha protein, Structural Genomics, Protein Structure Initiative, OCSP, NESG, PSI, Northeast Structural Genomics Consortium, unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YJBJ_ECOLI _struct_ref.pdbx_db_accession P68206 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MNKDEAGGNWKQFKGKVKEQWGKLTDDDMTIIEGKRDQLVGKIQERYGYQKDQAEKEVVDWETRNEYRW _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RYK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P68206 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 69 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 69 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 8 ? TRP A 21 ? GLY A 8 TRP A 21 1 ? 14 HELX_P HELX_P2 2 THR A 25 ? GLU A 33 ? THR A 25 GLU A 33 1 ? 9 HELX_P HELX_P3 3 LYS A 35 ? TYR A 47 ? LYS A 35 TYR A 47 1 ? 13 HELX_P HELX_P4 4 GLN A 50 ? GLU A 66 ? GLN A 50 GLU A 66 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 H A THR 25 ? ? OD1 A ASP 28 ? ? 1.57 2 2 OD2 A ASP 60 ? ? HH21 A ARG 64 ? ? 1.58 3 2 OD1 A ASP 52 ? ? HZ2 A LYS 56 ? ? 1.58 4 2 HZ2 A LYS 51 ? ? OE1 A GLU 55 ? ? 1.59 5 3 HB2 A LYS 35 ? ? HB2 A GLN 38 ? ? 1.34 6 4 HE1 A TRP 10 ? ? HA A THR 30 ? ? 1.34 7 5 HZ1 A LYS 14 ? ? OD2 A ASP 26 ? ? 1.54 8 5 HZ1 A LYS 3 ? ? OXT A TRP 69 ? ? 1.58 9 6 HZ3 A LYS 14 ? ? OD1 A ASP 26 ? ? 1.59 10 7 HG1 A THR 25 ? ? OD2 A ASP 28 ? ? 1.57 11 7 HZ1 A LYS 51 ? ? OE1 A GLU 55 ? ? 1.59 12 8 HB2 A LYS 35 ? ? HB2 A GLN 38 ? ? 1.30 13 9 HZ1 A LYS 14 ? ? OD1 A ASP 26 ? ? 1.58 14 9 OE2 A GLU 62 ? ? HH21 A ARG 68 ? ? 1.59 15 10 HG1 A THR 25 ? ? OD2 A ASP 28 ? ? 1.58 16 10 OE2 A GLU 33 ? ? HZ2 A LYS 35 ? ? 1.58 17 11 HH2 A TRP 10 ? ? HA A THR 30 ? ? 1.19 18 11 HG2 A LYS 23 ? ? HB3 A ARG 46 ? ? 1.24 19 12 OD1 A ASP 52 ? ? HZ2 A LYS 56 ? ? 1.60 20 12 HZ1 A LYS 3 ? ? OE2 A GLU 33 ? ? 1.60 21 13 H A THR 25 ? ? OD2 A ASP 28 ? ? 1.50 22 13 HZ2 A LYS 14 ? ? OD2 A ASP 26 ? ? 1.54 23 13 HZ1 A LYS 3 ? ? OXT A TRP 69 ? ? 1.59 24 14 OE1 A GLU 33 ? ? HZ2 A LYS 35 ? ? 1.58 25 14 HZ2 A LYS 51 ? ? OE2 A GLU 55 ? ? 1.58 26 14 OD2 A ASP 52 ? ? HZ3 A LYS 56 ? ? 1.60 27 16 HZ1 A LYS 3 ? ? OE2 A GLU 33 ? ? 1.58 28 17 HD21 A ASN 9 ? ? HE1 A TYR 67 ? ? 1.29 29 17 HZ3 A LYS 51 ? ? OE2 A GLU 55 ? ? 1.58 30 17 HZ2 A LYS 14 ? ? OD1 A ASP 26 ? ? 1.59 31 18 HE2 A PHE 13 ? ? HD2 A TYR 67 ? ? 1.30 32 18 OD2 A ASP 60 ? ? HH12 A ARG 64 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 6 ? ? -93.05 39.21 2 1 TRP A 21 ? ? -94.82 -75.75 3 1 GLU A 33 ? ? 65.44 -60.03 4 1 ASN A 65 ? ? -103.57 -66.89 5 1 GLU A 66 ? ? 78.04 -1.80 6 2 TRP A 21 ? ? -102.27 -76.28 7 2 ILE A 32 ? ? -71.72 -70.39 8 2 GLU A 33 ? ? 66.83 -58.32 9 2 GLU A 66 ? ? 83.85 -1.71 10 3 TRP A 21 ? ? -105.57 -60.77 11 3 GLU A 33 ? ? 63.82 -60.57 12 3 GLU A 66 ? ? 78.29 -44.44 13 4 ALA A 6 ? ? 66.75 144.98 14 4 TRP A 21 ? ? -102.46 -75.65 15 4 GLU A 33 ? ? 58.25 -52.01 16 4 ASN A 65 ? ? -102.93 -61.87 17 4 GLU A 66 ? ? 71.70 -17.93 18 4 ARG A 68 ? ? -147.36 -19.44 19 5 GLU A 33 ? ? 67.48 -59.91 20 5 GLU A 66 ? ? 78.90 -46.16 21 5 TYR A 67 ? ? -54.62 108.87 22 5 ARG A 68 ? ? 172.94 -51.47 23 6 GLU A 33 ? ? 66.75 -58.31 24 6 GLU A 66 ? ? 87.49 -2.52 25 6 ARG A 68 ? ? -157.77 -39.10 26 7 TRP A 21 ? ? -94.69 -76.43 27 7 ILE A 32 ? ? -82.33 -77.31 28 7 GLU A 33 ? ? 66.08 -59.73 29 7 GLU A 66 ? ? 78.91 -44.11 30 7 ARG A 68 ? ? -168.78 -75.92 31 8 GLU A 33 ? ? 67.59 -58.51 32 8 GLU A 66 ? ? 80.36 -31.46 33 8 ARG A 68 ? ? -148.95 -20.95 34 9 GLU A 33 ? ? 66.03 -58.25 35 9 ASN A 65 ? ? -104.63 -71.52 36 9 GLU A 66 ? ? 73.31 -3.42 37 9 ARG A 68 ? ? -154.68 -39.11 38 10 ILE A 32 ? ? -85.68 -71.90 39 10 GLU A 33 ? ? 50.26 -57.89 40 10 GLU A 66 ? ? 80.56 -1.37 41 10 ARG A 68 ? ? -139.11 -81.13 42 11 ALA A 6 ? ? -66.64 91.65 43 11 TRP A 21 ? ? -113.75 -74.62 44 11 GLU A 33 ? ? 65.58 -57.95 45 11 GLU A 66 ? ? 92.80 -25.53 46 12 ALA A 6 ? ? -48.33 96.28 47 12 GLN A 20 ? ? -90.17 -63.25 48 12 THR A 25 ? ? -127.33 -167.35 49 12 ILE A 32 ? ? -90.06 -81.21 50 12 GLU A 33 ? ? 54.20 -47.95 51 12 GLU A 66 ? ? 75.13 -27.08 52 12 TYR A 67 ? ? -65.93 94.00 53 12 ARG A 68 ? ? -164.76 -55.47 54 13 GLU A 33 ? ? -27.90 -59.06 55 13 GLU A 66 ? ? 85.23 -44.32 56 14 TRP A 21 ? ? -125.19 -55.31 57 14 GLU A 33 ? ? 64.83 -59.24 58 14 GLU A 66 ? ? 79.20 -1.41 59 15 ALA A 6 ? ? -64.30 87.49 60 15 TRP A 21 ? ? -122.95 -55.80 61 15 GLU A 66 ? ? 81.19 -38.11 62 15 ARG A 68 ? ? -179.07 -43.74 63 16 ALA A 6 ? ? -161.74 27.84 64 16 TRP A 21 ? ? -83.76 -74.34 65 16 GLU A 33 ? ? 68.87 -58.60 66 16 GLU A 66 ? ? 86.48 -35.81 67 17 ALA A 6 ? ? 63.77 -70.58 68 17 GLU A 33 ? ? 47.37 -60.20 69 17 GLU A 66 ? ? 76.85 -12.08 70 18 GLU A 33 ? ? -28.08 -58.66 71 18 ASN A 65 ? ? -103.84 -61.89 72 18 GLU A 66 ? ? 88.04 -32.76 73 18 ARG A 68 ? ? -156.09 2.71 74 19 TRP A 21 ? ? -114.94 -70.29 75 19 GLU A 66 ? ? 79.58 -41.63 76 20 THR A 25 ? ? -106.11 -167.46 77 20 GLU A 33 ? ? 69.00 -59.84 78 20 GLU A 66 ? ? 75.55 -0.52 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 1RYK _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RYK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3d_13c-separated_noesy 2 1 1 3d_15n-separated_noesy # _pdbx_nmr_refine.entry_id 1RYK _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing, restrained molecular dynamic simulations' _pdbx_nmr_refine.details '2036 noe-derived distance constraints, 101 dihedral angle constraints, 62 hydrogen bonds' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.1 processing 'delaglio, f' 1 DYANA 1.5 'structure solution' 'gunter, p.' 2 CNS 1.0 refinement ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 THR N N N N 235 THR CA C N S 236 THR C C N N 237 THR O O N N 238 THR CB C N R 239 THR OG1 O N N 240 THR CG2 C N N 241 THR OXT O N N 242 THR H H N N 243 THR H2 H N N 244 THR HA H N N 245 THR HB H N N 246 THR HG1 H N N 247 THR HG21 H N N 248 THR HG22 H N N 249 THR HG23 H N N 250 THR HXT H N N 251 TRP N N N N 252 TRP CA C N S 253 TRP C C N N 254 TRP O O N N 255 TRP CB C N N 256 TRP CG C Y N 257 TRP CD1 C Y N 258 TRP CD2 C Y N 259 TRP NE1 N Y N 260 TRP CE2 C Y N 261 TRP CE3 C Y N 262 TRP CZ2 C Y N 263 TRP CZ3 C Y N 264 TRP CH2 C Y N 265 TRP OXT O N N 266 TRP H H N N 267 TRP H2 H N N 268 TRP HA H N N 269 TRP HB2 H N N 270 TRP HB3 H N N 271 TRP HD1 H N N 272 TRP HE1 H N N 273 TRP HE3 H N N 274 TRP HZ2 H N N 275 TRP HZ3 H N N 276 TRP HH2 H N N 277 TRP HXT H N N 278 TYR N N N N 279 TYR CA C N S 280 TYR C C N N 281 TYR O O N N 282 TYR CB C N N 283 TYR CG C Y N 284 TYR CD1 C Y N 285 TYR CD2 C Y N 286 TYR CE1 C Y N 287 TYR CE2 C Y N 288 TYR CZ C Y N 289 TYR OH O N N 290 TYR OXT O N N 291 TYR H H N N 292 TYR H2 H N N 293 TYR HA H N N 294 TYR HB2 H N N 295 TYR HB3 H N N 296 TYR HD1 H N N 297 TYR HD2 H N N 298 TYR HE1 H N N 299 TYR HE2 H N N 300 TYR HH H N N 301 TYR HXT H N N 302 VAL N N N N 303 VAL CA C N S 304 VAL C C N N 305 VAL O O N N 306 VAL CB C N N 307 VAL CG1 C N N 308 VAL CG2 C N N 309 VAL OXT O N N 310 VAL H H N N 311 VAL H2 H N N 312 VAL HA H N N 313 VAL HB H N N 314 VAL HG11 H N N 315 VAL HG12 H N N 316 VAL HG13 H N N 317 VAL HG21 H N N 318 VAL HG22 H N N 319 VAL HG23 H N N 320 VAL HXT H N N 321 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 THR N CA sing N N 224 THR N H sing N N 225 THR N H2 sing N N 226 THR CA C sing N N 227 THR CA CB sing N N 228 THR CA HA sing N N 229 THR C O doub N N 230 THR C OXT sing N N 231 THR CB OG1 sing N N 232 THR CB CG2 sing N N 233 THR CB HB sing N N 234 THR OG1 HG1 sing N N 235 THR CG2 HG21 sing N N 236 THR CG2 HG22 sing N N 237 THR CG2 HG23 sing N N 238 THR OXT HXT sing N N 239 TRP N CA sing N N 240 TRP N H sing N N 241 TRP N H2 sing N N 242 TRP CA C sing N N 243 TRP CA CB sing N N 244 TRP CA HA sing N N 245 TRP C O doub N N 246 TRP C OXT sing N N 247 TRP CB CG sing N N 248 TRP CB HB2 sing N N 249 TRP CB HB3 sing N N 250 TRP CG CD1 doub Y N 251 TRP CG CD2 sing Y N 252 TRP CD1 NE1 sing Y N 253 TRP CD1 HD1 sing N N 254 TRP CD2 CE2 doub Y N 255 TRP CD2 CE3 sing Y N 256 TRP NE1 CE2 sing Y N 257 TRP NE1 HE1 sing N N 258 TRP CE2 CZ2 sing Y N 259 TRP CE3 CZ3 doub Y N 260 TRP CE3 HE3 sing N N 261 TRP CZ2 CH2 doub Y N 262 TRP CZ2 HZ2 sing N N 263 TRP CZ3 CH2 sing Y N 264 TRP CZ3 HZ3 sing N N 265 TRP CH2 HH2 sing N N 266 TRP OXT HXT sing N N 267 TYR N CA sing N N 268 TYR N H sing N N 269 TYR N H2 sing N N 270 TYR CA C sing N N 271 TYR CA CB sing N N 272 TYR CA HA sing N N 273 TYR C O doub N N 274 TYR C OXT sing N N 275 TYR CB CG sing N N 276 TYR CB HB2 sing N N 277 TYR CB HB3 sing N N 278 TYR CG CD1 doub Y N 279 TYR CG CD2 sing Y N 280 TYR CD1 CE1 sing Y N 281 TYR CD1 HD1 sing N N 282 TYR CD2 CE2 doub Y N 283 TYR CD2 HD2 sing N N 284 TYR CE1 CZ doub Y N 285 TYR CE1 HE1 sing N N 286 TYR CE2 CZ sing Y N 287 TYR CE2 HE2 sing N N 288 TYR CZ OH sing N N 289 TYR OH HH sing N N 290 TYR OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1RYK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_