data_1S3A # _entry.id 1S3A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1S3A pdb_00001s3a 10.2210/pdb1s3a/pdb RCSB RCSB021312 ? ? WWPDB D_1000021312 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1S3A _pdbx_database_status.recvd_initial_deposition_date 2004-01-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Brockmann, C.' 1 'Diehl, A.' 2 'Rehbein, K.' 3 'Kuhne, R.' 4 'Oschkinat, H.' 5 # _citation.id primary _citation.title 'The oxidized subunit B8 from human complex I adopts a thioredoxin fold.' _citation.journal_abbrev Structure _citation.journal_volume 12 _citation.page_first 1645 _citation.page_last 1654 _citation.year 2004 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15341729 _citation.pdbx_database_id_DOI 10.1016/j.str.2004.06.021 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brockmann, C.' 1 ? primary 'Diehl, A.' 2 ? primary 'Rehbein, K.' 3 ? primary 'Strauss, H.' 4 ? primary 'Schmieder, P.' 5 ? primary 'Korn, B.' 6 ? primary 'Kuhne, R.' 7 ? primary 'Oschkinat, H.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'NADH-ubiquinone oxidoreductase B8 subunit' _entity.formula_weight 11194.873 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec '1.6.5.3, 1.6.99.3' _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Complex I-B8, CI-B8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KAGMAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNV PLNNFSADQVTRALENVLSGKA ; _entity_poly.pdbx_seq_one_letter_code_can ;KAGMAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNV PLNNFSADQVTRALENVLSGKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 ALA n 1 3 GLY n 1 4 MET n 1 5 ALA n 1 6 ALA n 1 7 ALA n 1 8 ALA n 1 9 ALA n 1 10 SER n 1 11 ARG n 1 12 GLY n 1 13 VAL n 1 14 GLY n 1 15 ALA n 1 16 LYS n 1 17 LEU n 1 18 GLY n 1 19 LEU n 1 20 ARG n 1 21 GLU n 1 22 ILE n 1 23 ARG n 1 24 ILE n 1 25 HIS n 1 26 LEU n 1 27 CYS n 1 28 GLN n 1 29 ARG n 1 30 SER n 1 31 PRO n 1 32 GLY n 1 33 SER n 1 34 GLN n 1 35 GLY n 1 36 VAL n 1 37 ARG n 1 38 ASP n 1 39 PHE n 1 40 ILE n 1 41 GLU n 1 42 LYS n 1 43 ARG n 1 44 TYR n 1 45 VAL n 1 46 GLU n 1 47 LEU n 1 48 LYS n 1 49 LYS n 1 50 ALA n 1 51 ASN n 1 52 PRO n 1 53 ASP n 1 54 LEU n 1 55 PRO n 1 56 ILE n 1 57 LEU n 1 58 ILE n 1 59 ARG n 1 60 GLU n 1 61 CYS n 1 62 SER n 1 63 ASP n 1 64 VAL n 1 65 GLN n 1 66 PRO n 1 67 LYS n 1 68 LEU n 1 69 TRP n 1 70 ALA n 1 71 ARG n 1 72 TYR n 1 73 ALA n 1 74 PHE n 1 75 GLY n 1 76 GLN n 1 77 GLU n 1 78 THR n 1 79 ASN n 1 80 VAL n 1 81 PRO n 1 82 LEU n 1 83 ASN n 1 84 ASN n 1 85 PHE n 1 86 SER n 1 87 ALA n 1 88 ASP n 1 89 GLN n 1 90 VAL n 1 91 THR n 1 92 ARG n 1 93 ALA n 1 94 LEU n 1 95 GLU n 1 96 ASN n 1 97 VAL n 1 98 LEU n 1 99 SER n 1 100 GLY n 1 101 LYS n 1 102 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene NDUFA2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pDEST17 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NI8M_HUMAN _struct_ref.pdbx_db_accession O43678 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLN NFSADQVTRALENVLSGKA ; _struct_ref.pdbx_align_begin 0 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1S3A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O43678 _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 99 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1S3A LYS A 1 ? UNP O43678 ? ? 'cloning artifact' -2 1 1 1S3A ALA A 2 ? UNP O43678 ? ? 'cloning artifact' -1 2 1 1S3A GLY A 3 ? UNP O43678 ? ? 'cloning artifact' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 3 1 3D_13C-separated_NOESY 3 3 1 '2D NOESY' 4 2 1 3D_13C-separated_NOESY 5 3 1 3D_13C_methyl_selective_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20mM phosphate, 50mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 'U-15N, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 'U-15N, U-13C, 90% H2O, 10% D2O' '90% H2O/10% D2O' 3 'U-15N, U-13C, 100% D2O' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 750 2 ? Bruker DRX 600 # _pdbx_nmr_refine.entry_id 1S3A _pdbx_nmr_refine.method 'simulated anealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1S3A _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1S3A _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 19 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1S3A _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.1 collection Bruker 1 Sparky 3.10 'data analysis' 'T.D.Goddard and D.G.Kneller' 2 CYANA ? 'data analysis' 'Gunther, T.' 3 CNS 1.0 refinement 'Brunger, A.' 4 # _exptl.entry_id 1S3A _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1S3A _struct.title 'NMR Solution Structure of Subunit B8 from Human NADH-Ubiquinone Oxidoreductase Complex I (CI-B8)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1S3A _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'CI-B8, NDUFA2, Complex I, OXIDOREDUCTASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 33 ? ARG A 43 ? SER A 30 ARG A 40 1 ? 11 HELX_P HELX_P2 2 ARG A 43 ? ASN A 51 ? ARG A 40 ASN A 48 1 ? 9 HELX_P HELX_P3 3 SER A 86 ? LYS A 101 ? SER A 83 LYS A 98 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 27 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 61 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 24 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 58 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.031 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 56 ? ARG A 59 ? ILE A 53 ARG A 56 A 2 LEU A 19 ? HIS A 25 ? LEU A 16 HIS A 22 A 3 LYS A 67 ? TYR A 72 ? LYS A 64 TYR A 69 A 4 GLU A 77 ? PRO A 81 ? GLU A 74 PRO A 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 59 ? O ARG A 56 N ILE A 24 ? N ILE A 21 A 2 3 N GLU A 21 ? N GLU A 18 O ARG A 71 ? O ARG A 68 A 3 4 N ALA A 70 ? N ALA A 67 O THR A 78 ? O THR A 75 # _database_PDB_matrix.entry_id 1S3A _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1S3A _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 -2 ? ? ? A . n A 1 2 ALA 2 -1 ? ? ? A . n A 1 3 GLY 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 ALA 5 2 ? ? ? A . n A 1 6 ALA 6 3 ? ? ? A . n A 1 7 ALA 7 4 ? ? ? A . n A 1 8 ALA 8 5 ? ? ? A . n A 1 9 ALA 9 6 ? ? ? A . n A 1 10 SER 10 7 ? ? ? A . n A 1 11 ARG 11 8 ? ? ? A . n A 1 12 GLY 12 9 ? ? ? A . n A 1 13 VAL 13 10 ? ? ? A . n A 1 14 GLY 14 11 ? ? ? A . n A 1 15 ALA 15 12 ? ? ? A . n A 1 16 LYS 16 13 ? ? ? A . n A 1 17 LEU 17 14 ? ? ? A . n A 1 18 GLY 18 15 15 GLY GLY A . n A 1 19 LEU 19 16 16 LEU LEU A . n A 1 20 ARG 20 17 17 ARG ARG A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 ILE 22 19 19 ILE ILE A . n A 1 23 ARG 23 20 20 ARG ARG A . n A 1 24 ILE 24 21 21 ILE ILE A . n A 1 25 HIS 25 22 22 HIS HIS A . n A 1 26 LEU 26 23 23 LEU LEU A . n A 1 27 CYS 27 24 24 CYS CYS A . n A 1 28 GLN 28 25 25 GLN GLN A . n A 1 29 ARG 29 26 26 ARG ARG A . n A 1 30 SER 30 27 27 SER SER A . n A 1 31 PRO 31 28 28 PRO PRO A . n A 1 32 GLY 32 29 29 GLY GLY A . n A 1 33 SER 33 30 30 SER SER A . n A 1 34 GLN 34 31 31 GLN GLN A . n A 1 35 GLY 35 32 32 GLY GLY A . n A 1 36 VAL 36 33 33 VAL VAL A . n A 1 37 ARG 37 34 34 ARG ARG A . n A 1 38 ASP 38 35 35 ASP ASP A . n A 1 39 PHE 39 36 36 PHE PHE A . n A 1 40 ILE 40 37 37 ILE ILE A . n A 1 41 GLU 41 38 38 GLU GLU A . n A 1 42 LYS 42 39 39 LYS LYS A . n A 1 43 ARG 43 40 40 ARG ARG A . n A 1 44 TYR 44 41 41 TYR TYR A . n A 1 45 VAL 45 42 42 VAL VAL A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 LEU 47 44 44 LEU LEU A . n A 1 48 LYS 48 45 45 LYS LYS A . n A 1 49 LYS 49 46 46 LYS LYS A . n A 1 50 ALA 50 47 47 ALA ALA A . n A 1 51 ASN 51 48 48 ASN ASN A . n A 1 52 PRO 52 49 49 PRO PRO A . n A 1 53 ASP 53 50 50 ASP ASP A . n A 1 54 LEU 54 51 51 LEU LEU A . n A 1 55 PRO 55 52 52 PRO PRO A . n A 1 56 ILE 56 53 53 ILE ILE A . n A 1 57 LEU 57 54 54 LEU LEU A . n A 1 58 ILE 58 55 55 ILE ILE A . n A 1 59 ARG 59 56 56 ARG ARG A . n A 1 60 GLU 60 57 57 GLU GLU A . n A 1 61 CYS 61 58 58 CYS CYS A . n A 1 62 SER 62 59 59 SER SER A . n A 1 63 ASP 63 60 60 ASP ASP A . n A 1 64 VAL 64 61 61 VAL VAL A . n A 1 65 GLN 65 62 62 GLN GLN A . n A 1 66 PRO 66 63 63 PRO PRO A . n A 1 67 LYS 67 64 64 LYS LYS A . n A 1 68 LEU 68 65 65 LEU LEU A . n A 1 69 TRP 69 66 66 TRP TRP A . n A 1 70 ALA 70 67 67 ALA ALA A . n A 1 71 ARG 71 68 68 ARG ARG A . n A 1 72 TYR 72 69 69 TYR TYR A . n A 1 73 ALA 73 70 70 ALA ALA A . n A 1 74 PHE 74 71 71 PHE PHE A . n A 1 75 GLY 75 72 72 GLY GLY A . n A 1 76 GLN 76 73 73 GLN GLN A . n A 1 77 GLU 77 74 74 GLU GLU A . n A 1 78 THR 78 75 75 THR THR A . n A 1 79 ASN 79 76 76 ASN ASN A . n A 1 80 VAL 80 77 77 VAL VAL A . n A 1 81 PRO 81 78 78 PRO PRO A . n A 1 82 LEU 82 79 79 LEU LEU A . n A 1 83 ASN 83 80 80 ASN ASN A . n A 1 84 ASN 84 81 81 ASN ASN A . n A 1 85 PHE 85 82 82 PHE PHE A . n A 1 86 SER 86 83 83 SER SER A . n A 1 87 ALA 87 84 84 ALA ALA A . n A 1 88 ASP 88 85 85 ASP ASP A . n A 1 89 GLN 89 86 86 GLN GLN A . n A 1 90 VAL 90 87 87 VAL VAL A . n A 1 91 THR 91 88 88 THR THR A . n A 1 92 ARG 92 89 89 ARG ARG A . n A 1 93 ALA 93 90 90 ALA ALA A . n A 1 94 LEU 94 91 91 LEU LEU A . n A 1 95 GLU 95 92 92 GLU GLU A . n A 1 96 ASN 96 93 93 ASN ASN A . n A 1 97 VAL 97 94 94 VAL VAL A . n A 1 98 LEU 98 95 95 LEU LEU A . n A 1 99 SER 99 96 96 SER SER A . n A 1 100 GLY 100 97 97 GLY GLY A . n A 1 101 LYS 101 98 98 LYS LYS A . n A 1 102 ALA 102 99 99 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-01-25 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.24 2 1 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.25 3 1 HB1 A ALA 67 ? ? HB A THR 75 ? ? 1.27 4 1 HB2 A SER 30 ? ? HD21 A ASN 80 ? ? 1.33 5 1 HA A VAL 94 ? ? HB2 A LYS 98 ? ? 1.33 6 2 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.24 7 2 HE1 A TYR 41 ? ? HD11 A ILE 55 ? ? 1.27 8 2 HG11 A VAL 33 ? ? HD12 A LEU 79 ? ? 1.29 9 2 HD11 A ILE 21 ? ? HE1 A PHE 36 ? ? 1.30 10 2 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.32 11 2 HB3 A SER 30 ? ? HG21 A VAL 33 ? ? 1.32 12 2 HB3 A ASP 35 ? ? HB1 A ALA 84 ? ? 1.34 13 2 OD2 A ASP 60 ? ? HZ3 A LYS 64 ? ? 1.54 14 2 OE2 A GLU 92 ? ? HG A SER 96 ? ? 1.60 15 3 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.13 16 3 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.24 17 3 HG2 A ARG 40 ? ? HG22 A THR 88 ? ? 1.29 18 4 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.13 19 4 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.24 20 4 HB3 A ASP 35 ? ? HB1 A ALA 84 ? ? 1.26 21 5 HB3 A ASP 35 ? ? HB2 A ALA 84 ? ? 1.24 22 5 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.34 23 6 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.16 24 6 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.24 25 6 HB3 A ASP 35 ? ? HB2 A ALA 84 ? ? 1.24 26 7 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.19 27 7 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.28 28 8 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.21 29 8 HD12 A ILE 21 ? ? HE1 A PHE 36 ? ? 1.33 30 8 O A GLN 62 ? ? HZ2 A LYS 64 ? ? 1.59 31 9 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.22 32 9 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.29 33 9 HA A PHE 36 ? ? HB3 A ARG 40 ? ? 1.30 34 10 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.20 35 10 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.26 36 11 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.23 37 11 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.24 38 12 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.15 39 12 HA A VAL 94 ? ? HB2 A LYS 98 ? ? 1.25 40 12 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.26 41 12 O A GLN 62 ? ? HZ3 A LYS 64 ? ? 1.56 42 13 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.15 43 13 HB3 A ALA 67 ? ? HB A THR 75 ? ? 1.27 44 13 HB3 A ASP 35 ? ? HB3 A ALA 84 ? ? 1.28 45 13 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.34 46 14 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.19 47 14 HG A LEU 23 ? ? H A CYS 24 ? ? 1.19 48 14 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.23 49 14 HB3 A ASP 35 ? ? HB3 A ALA 84 ? ? 1.28 50 14 HA A VAL 94 ? ? HB2 A LYS 98 ? ? 1.33 51 15 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.22 52 15 HD11 A ILE 21 ? ? HE1 A PHE 36 ? ? 1.24 53 15 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.25 54 15 OD2 A ASP 60 ? ? HZ3 A LYS 64 ? ? 1.57 55 15 OG A SER 59 ? ? HZ2 A LYS 64 ? ? 1.58 56 16 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.13 57 16 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.21 58 16 OE1 A GLU 38 ? ? HZ3 A LYS 39 ? ? 1.60 59 17 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.19 60 17 HB3 A SER 30 ? ? HG21 A VAL 33 ? ? 1.23 61 17 HB3 A ASP 35 ? ? HB2 A ALA 84 ? ? 1.26 62 17 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.28 63 17 HD13 A ILE 21 ? ? HE1 A PHE 36 ? ? 1.29 64 18 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.15 65 18 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.19 66 18 HG2 A ARG 40 ? ? HG21 A THR 88 ? ? 1.26 67 18 HA A VAL 94 ? ? HB2 A LYS 98 ? ? 1.28 68 18 HA A LYS 45 ? ? HD11 A ILE 53 ? ? 1.31 69 19 HA A VAL 94 ? ? HB2 A LYS 98 ? ? 1.13 70 19 HZ3 A TRP 66 ? ? HD21 A ASN 76 ? ? 1.17 71 19 HE3 A TRP 66 ? ? HB3 A ASN 76 ? ? 1.20 72 19 HG11 A VAL 33 ? ? HD12 A LEU 79 ? ? 1.22 73 19 HB3 A ASP 35 ? ? HB3 A ALA 84 ? ? 1.32 74 19 HD13 A ILE 21 ? ? HE1 A PHE 36 ? ? 1.32 75 19 HB3 A ALA 67 ? ? HB A THR 75 ? ? 1.34 76 19 O A GLN 62 ? ? HZ1 A LYS 64 ? ? 1.57 77 19 O A VAL 33 ? ? H A ILE 37 ? ? 1.57 78 19 O A SER 27 ? ? H A GLY 29 ? ? 1.59 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 19 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 SER _pdbx_validate_rmsd_angle.auth_seq_id_1 27 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 28 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 28 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.93 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 10.63 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 23 ? ? -108.82 -98.64 2 1 CYS A 24 ? ? 73.93 170.41 3 1 ARG A 26 ? ? -155.12 -59.19 4 1 PRO A 28 ? ? -27.05 117.14 5 1 TYR A 41 ? ? -41.49 -72.88 6 1 CYS A 58 ? ? -23.34 123.03 7 1 SER A 59 ? ? -151.26 -42.51 8 1 ASP A 60 ? ? -143.70 -132.91 9 1 VAL A 61 ? ? -59.83 -73.10 10 1 GLN A 62 ? ? -166.66 -83.01 11 1 PRO A 78 ? ? -46.04 106.23 12 2 ARG A 26 ? ? -141.20 -67.89 13 2 PRO A 28 ? ? -34.77 103.52 14 2 GLU A 38 ? ? -106.15 -61.20 15 2 ASP A 50 ? ? -87.18 33.46 16 2 SER A 59 ? ? -144.61 -0.23 17 2 ASP A 60 ? ? -145.63 -92.04 18 2 VAL A 61 ? ? -83.75 -79.81 19 2 GLN A 62 ? ? -165.92 -80.41 20 2 PRO A 78 ? ? -50.57 105.42 21 2 LYS A 98 ? ? -101.67 -69.09 22 3 LEU A 23 ? ? -110.50 -129.10 23 3 CYS A 24 ? ? 75.16 82.62 24 3 ARG A 26 ? ? -163.35 -48.59 25 3 PRO A 28 ? ? -31.56 104.06 26 3 GLU A 38 ? ? -104.24 -61.87 27 3 ASP A 50 ? ? -86.08 44.45 28 3 GLN A 62 ? ? -177.31 -62.47 29 3 PRO A 63 ? ? -105.72 75.76 30 3 PRO A 78 ? ? -50.52 106.91 31 4 GLN A 25 ? ? -144.76 46.03 32 4 SER A 27 ? ? -105.95 -169.43 33 4 PRO A 28 ? ? -22.12 101.91 34 4 GLU A 38 ? ? -103.27 -61.96 35 4 TYR A 41 ? ? -41.84 -73.30 36 4 CYS A 58 ? ? 52.81 -148.89 37 4 SER A 59 ? ? 91.69 -5.35 38 4 ASP A 60 ? ? -147.96 -139.09 39 4 GLN A 62 ? ? -168.09 -75.28 40 4 PRO A 63 ? ? -107.36 78.56 41 4 THR A 75 ? ? -173.11 148.86 42 5 CYS A 24 ? ? 170.76 -176.29 43 5 ARG A 26 ? ? -133.47 -62.27 44 5 SER A 27 ? ? -110.95 -162.37 45 5 PRO A 28 ? ? -18.21 88.84 46 5 GLU A 38 ? ? -105.44 -61.92 47 5 TYR A 41 ? ? -35.83 -72.43 48 5 ASP A 50 ? ? -84.83 38.87 49 5 CYS A 58 ? ? 35.82 -87.01 50 5 SER A 59 ? ? 73.32 -68.92 51 5 ASP A 60 ? ? -148.63 -81.57 52 5 VAL A 61 ? ? -83.71 -92.75 53 5 GLN A 62 ? ? -162.53 -82.87 54 6 LEU A 16 ? ? -77.54 -167.68 55 6 LEU A 23 ? ? -110.46 -123.80 56 6 CYS A 24 ? ? 78.76 163.58 57 6 ARG A 26 ? ? -138.64 -46.61 58 6 PRO A 28 ? ? -19.75 98.91 59 6 GLU A 38 ? ? -105.37 -61.13 60 6 TYR A 41 ? ? -34.75 -72.22 61 6 ASP A 50 ? ? -89.18 30.23 62 6 SER A 59 ? ? -151.17 -55.78 63 6 ASP A 60 ? ? -108.61 -73.06 64 6 VAL A 61 ? ? -93.18 -86.94 65 6 GLN A 62 ? ? -166.46 -79.34 66 7 ARG A 26 ? ? -143.07 -73.62 67 7 PRO A 28 ? ? -26.32 97.97 68 7 GLU A 38 ? ? -105.80 -61.83 69 7 ASP A 60 ? ? -110.55 -93.03 70 7 VAL A 61 ? ? -92.17 -76.60 71 7 GLN A 62 ? ? -165.35 -83.33 72 7 PRO A 78 ? ? -51.99 106.91 73 8 LEU A 23 ? ? -106.43 -138.59 74 8 CYS A 24 ? ? 84.32 94.96 75 8 ARG A 26 ? ? -144.68 -67.36 76 8 PRO A 28 ? ? -34.88 102.18 77 8 TYR A 41 ? ? -35.25 -70.43 78 8 SER A 59 ? ? -176.67 -75.60 79 8 VAL A 61 ? ? 77.58 -69.48 80 8 GLN A 62 ? ? -167.88 -70.53 81 8 THR A 75 ? ? -172.01 143.81 82 9 LEU A 23 ? ? -108.38 -167.75 83 9 CYS A 24 ? ? 177.90 136.19 84 9 PRO A 28 ? ? -21.84 109.65 85 9 GLU A 38 ? ? -105.53 -61.64 86 9 CYS A 58 ? ? -17.31 -99.65 87 9 SER A 59 ? ? 67.35 -34.26 88 9 ASP A 60 ? ? -121.90 -101.13 89 9 GLN A 62 ? ? -166.32 -72.75 90 9 PRO A 78 ? ? -54.23 106.42 91 9 ASN A 80 ? ? -38.34 -32.05 92 9 LYS A 98 ? ? -100.10 -69.71 93 10 LEU A 23 ? ? -98.49 -120.28 94 10 CYS A 24 ? ? 75.44 97.53 95 10 GLN A 25 ? ? -76.89 24.35 96 10 PRO A 28 ? ? -18.29 116.92 97 10 ASP A 50 ? ? -83.38 30.12 98 10 CYS A 58 ? ? 70.07 162.82 99 10 SER A 59 ? ? 162.19 -53.32 100 10 GLN A 62 ? ? -167.01 -64.73 101 10 PRO A 78 ? ? -57.30 104.30 102 11 GLU A 18 ? ? -170.92 147.77 103 11 PRO A 28 ? ? -21.87 104.63 104 11 GLU A 38 ? ? -105.67 -62.31 105 11 TYR A 41 ? ? -35.00 -73.04 106 11 ASP A 50 ? ? -86.04 41.06 107 11 GLN A 62 ? ? -155.63 -74.13 108 11 PRO A 78 ? ? -57.47 104.00 109 11 LYS A 98 ? ? -98.92 -62.44 110 12 LEU A 23 ? ? -107.77 -131.60 111 12 CYS A 24 ? ? 81.24 171.22 112 12 PRO A 28 ? ? -34.19 148.19 113 12 TYR A 41 ? ? -37.11 -73.69 114 12 CYS A 58 ? ? -65.96 91.84 115 12 VAL A 61 ? ? -18.02 -76.23 116 12 GLN A 62 ? ? -158.02 -86.48 117 12 PRO A 78 ? ? -51.01 102.09 118 13 CYS A 24 ? ? 170.51 -169.38 119 13 ARG A 26 ? ? -138.21 -38.00 120 13 PRO A 28 ? ? -19.95 105.38 121 13 GLU A 38 ? ? -106.42 -61.08 122 13 CYS A 58 ? ? -29.53 132.06 123 13 SER A 59 ? ? -152.80 -36.62 124 13 ASP A 60 ? ? -143.76 -119.64 125 13 VAL A 61 ? ? -77.71 -72.90 126 13 GLN A 62 ? ? -148.51 -86.38 127 13 PRO A 78 ? ? -44.59 109.68 128 13 LYS A 98 ? ? -99.66 -63.66 129 14 LEU A 23 ? ? -94.85 -145.44 130 14 CYS A 24 ? ? 97.45 131.14 131 14 GLN A 25 ? ? -101.82 65.74 132 14 ARG A 26 ? ? -100.06 -60.10 133 14 PRO A 28 ? ? -10.30 -73.32 134 14 GLU A 38 ? ? -103.26 -61.48 135 14 TYR A 41 ? ? -45.19 -73.61 136 14 CYS A 58 ? ? 71.08 152.59 137 14 SER A 59 ? ? 166.88 -70.64 138 14 ASP A 60 ? ? -108.09 -163.47 139 14 GLN A 62 ? ? -149.03 -76.01 140 14 PRO A 78 ? ? -43.35 108.44 141 15 LEU A 23 ? ? -120.22 -102.11 142 15 CYS A 24 ? ? 69.64 177.11 143 15 ARG A 26 ? ? -152.58 -47.88 144 15 TYR A 41 ? ? -35.90 -70.62 145 15 SER A 59 ? ? -162.98 -33.19 146 15 ASP A 60 ? ? -123.11 -86.13 147 15 VAL A 61 ? ? -83.12 -85.28 148 15 GLN A 62 ? ? -166.36 -71.80 149 15 PRO A 78 ? ? -39.31 116.44 150 16 LEU A 23 ? ? -104.38 -155.65 151 16 CYS A 24 ? ? 74.65 151.51 152 16 GLN A 25 ? ? 93.47 147.34 153 16 ARG A 26 ? ? -109.86 64.72 154 16 PRO A 28 ? ? -37.78 104.71 155 16 TYR A 41 ? ? -33.98 -73.77 156 16 ASP A 50 ? ? -81.89 32.64 157 16 CYS A 58 ? ? 75.48 114.75 158 16 SER A 59 ? ? -165.34 -54.09 159 16 ASP A 60 ? ? -143.51 -155.69 160 16 GLN A 62 ? ? -176.03 -66.81 161 16 THR A 75 ? ? -171.95 145.87 162 16 PRO A 78 ? ? -44.44 104.65 163 17 LEU A 23 ? ? -96.83 -91.62 164 17 CYS A 24 ? ? 60.78 169.07 165 17 ARG A 26 ? ? -129.46 -73.01 166 17 PRO A 28 ? ? -27.60 -55.27 167 17 ASP A 50 ? ? -84.06 42.48 168 17 SER A 59 ? ? -148.56 -48.14 169 17 ASP A 60 ? ? -99.61 -101.05 170 17 GLN A 62 ? ? 114.60 -79.13 171 17 PRO A 78 ? ? -40.45 108.76 172 17 LYS A 98 ? ? -100.31 -64.79 173 18 LEU A 23 ? ? -101.25 -115.54 174 18 CYS A 24 ? ? 58.68 105.41 175 18 PRO A 28 ? ? -34.94 95.11 176 18 GLU A 38 ? ? -103.96 -61.57 177 18 ASP A 50 ? ? -84.23 31.41 178 18 ASP A 60 ? ? -117.49 -159.70 179 18 GLN A 62 ? ? -169.67 -71.81 180 18 PRO A 78 ? ? -49.21 103.08 181 18 LYS A 98 ? ? -98.72 -64.75 182 19 LEU A 23 ? ? -107.24 -110.73 183 19 CYS A 24 ? ? 77.26 155.29 184 19 ARG A 26 ? ? -135.99 -40.54 185 19 PRO A 28 ? ? -18.82 12.57 186 19 GLN A 62 ? ? -151.61 -82.13 187 19 PRO A 78 ? ? -46.42 109.48 188 19 LYS A 98 ? ? -99.02 -64.92 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 4 ARG A 34 ? ? 0.086 'SIDE CHAIN' 2 4 ARG A 68 ? ? 0.095 'SIDE CHAIN' 3 8 ARG A 40 ? ? 0.086 'SIDE CHAIN' 4 9 ARG A 68 ? ? 0.079 'SIDE CHAIN' 5 11 ARG A 26 ? ? 0.078 'SIDE CHAIN' 6 11 ARG A 68 ? ? 0.088 'SIDE CHAIN' 7 14 ARG A 20 ? ? 0.087 'SIDE CHAIN' 8 14 ARG A 89 ? ? 0.074 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS -2 ? A LYS 1 2 1 Y 1 A ALA -1 ? A ALA 2 3 1 Y 1 A GLY 0 ? A GLY 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A ALA 2 ? A ALA 5 6 1 Y 1 A ALA 3 ? A ALA 6 7 1 Y 1 A ALA 4 ? A ALA 7 8 1 Y 1 A ALA 5 ? A ALA 8 9 1 Y 1 A ALA 6 ? A ALA 9 10 1 Y 1 A SER 7 ? A SER 10 11 1 Y 1 A ARG 8 ? A ARG 11 12 1 Y 1 A GLY 9 ? A GLY 12 13 1 Y 1 A VAL 10 ? A VAL 13 14 1 Y 1 A GLY 11 ? A GLY 14 15 1 Y 1 A ALA 12 ? A ALA 15 16 1 Y 1 A LYS 13 ? A LYS 16 17 1 Y 1 A LEU 14 ? A LEU 17 18 2 Y 1 A LYS -2 ? A LYS 1 19 2 Y 1 A ALA -1 ? A ALA 2 20 2 Y 1 A GLY 0 ? A GLY 3 21 2 Y 1 A MET 1 ? A MET 4 22 2 Y 1 A ALA 2 ? A ALA 5 23 2 Y 1 A ALA 3 ? A ALA 6 24 2 Y 1 A ALA 4 ? A ALA 7 25 2 Y 1 A ALA 5 ? A ALA 8 26 2 Y 1 A ALA 6 ? A ALA 9 27 2 Y 1 A SER 7 ? A SER 10 28 2 Y 1 A ARG 8 ? A ARG 11 29 2 Y 1 A GLY 9 ? A GLY 12 30 2 Y 1 A VAL 10 ? A VAL 13 31 2 Y 1 A GLY 11 ? A GLY 14 32 2 Y 1 A ALA 12 ? A ALA 15 33 2 Y 1 A LYS 13 ? A LYS 16 34 2 Y 1 A LEU 14 ? A LEU 17 35 3 Y 1 A LYS -2 ? A LYS 1 36 3 Y 1 A ALA -1 ? A ALA 2 37 3 Y 1 A GLY 0 ? A GLY 3 38 3 Y 1 A MET 1 ? A MET 4 39 3 Y 1 A ALA 2 ? A ALA 5 40 3 Y 1 A ALA 3 ? A ALA 6 41 3 Y 1 A ALA 4 ? A ALA 7 42 3 Y 1 A ALA 5 ? A ALA 8 43 3 Y 1 A ALA 6 ? A ALA 9 44 3 Y 1 A SER 7 ? A SER 10 45 3 Y 1 A ARG 8 ? A ARG 11 46 3 Y 1 A GLY 9 ? A GLY 12 47 3 Y 1 A VAL 10 ? A VAL 13 48 3 Y 1 A GLY 11 ? A GLY 14 49 3 Y 1 A ALA 12 ? A ALA 15 50 3 Y 1 A LYS 13 ? A LYS 16 51 3 Y 1 A LEU 14 ? A LEU 17 52 4 Y 1 A LYS -2 ? A LYS 1 53 4 Y 1 A ALA -1 ? A ALA 2 54 4 Y 1 A GLY 0 ? A GLY 3 55 4 Y 1 A MET 1 ? A MET 4 56 4 Y 1 A ALA 2 ? A ALA 5 57 4 Y 1 A ALA 3 ? A ALA 6 58 4 Y 1 A ALA 4 ? A ALA 7 59 4 Y 1 A ALA 5 ? A ALA 8 60 4 Y 1 A ALA 6 ? A ALA 9 61 4 Y 1 A SER 7 ? A SER 10 62 4 Y 1 A ARG 8 ? A ARG 11 63 4 Y 1 A GLY 9 ? A GLY 12 64 4 Y 1 A VAL 10 ? A VAL 13 65 4 Y 1 A GLY 11 ? A GLY 14 66 4 Y 1 A ALA 12 ? A ALA 15 67 4 Y 1 A LYS 13 ? A LYS 16 68 4 Y 1 A LEU 14 ? A LEU 17 69 5 Y 1 A LYS -2 ? A LYS 1 70 5 Y 1 A ALA -1 ? A ALA 2 71 5 Y 1 A GLY 0 ? A GLY 3 72 5 Y 1 A MET 1 ? A MET 4 73 5 Y 1 A ALA 2 ? A ALA 5 74 5 Y 1 A ALA 3 ? A ALA 6 75 5 Y 1 A ALA 4 ? A ALA 7 76 5 Y 1 A ALA 5 ? A ALA 8 77 5 Y 1 A ALA 6 ? A ALA 9 78 5 Y 1 A SER 7 ? A SER 10 79 5 Y 1 A ARG 8 ? A ARG 11 80 5 Y 1 A GLY 9 ? A GLY 12 81 5 Y 1 A VAL 10 ? A VAL 13 82 5 Y 1 A GLY 11 ? A GLY 14 83 5 Y 1 A ALA 12 ? A ALA 15 84 5 Y 1 A LYS 13 ? A LYS 16 85 5 Y 1 A LEU 14 ? A LEU 17 86 6 Y 1 A LYS -2 ? A LYS 1 87 6 Y 1 A ALA -1 ? A ALA 2 88 6 Y 1 A GLY 0 ? A GLY 3 89 6 Y 1 A MET 1 ? A MET 4 90 6 Y 1 A ALA 2 ? A ALA 5 91 6 Y 1 A ALA 3 ? A ALA 6 92 6 Y 1 A ALA 4 ? A ALA 7 93 6 Y 1 A ALA 5 ? A ALA 8 94 6 Y 1 A ALA 6 ? A ALA 9 95 6 Y 1 A SER 7 ? A SER 10 96 6 Y 1 A ARG 8 ? A ARG 11 97 6 Y 1 A GLY 9 ? A GLY 12 98 6 Y 1 A VAL 10 ? A VAL 13 99 6 Y 1 A GLY 11 ? A GLY 14 100 6 Y 1 A ALA 12 ? A ALA 15 101 6 Y 1 A LYS 13 ? A LYS 16 102 6 Y 1 A LEU 14 ? A LEU 17 103 7 Y 1 A LYS -2 ? A LYS 1 104 7 Y 1 A ALA -1 ? A ALA 2 105 7 Y 1 A GLY 0 ? A GLY 3 106 7 Y 1 A MET 1 ? A MET 4 107 7 Y 1 A ALA 2 ? A ALA 5 108 7 Y 1 A ALA 3 ? A ALA 6 109 7 Y 1 A ALA 4 ? A ALA 7 110 7 Y 1 A ALA 5 ? A ALA 8 111 7 Y 1 A ALA 6 ? A ALA 9 112 7 Y 1 A SER 7 ? A SER 10 113 7 Y 1 A ARG 8 ? A ARG 11 114 7 Y 1 A GLY 9 ? A GLY 12 115 7 Y 1 A VAL 10 ? A VAL 13 116 7 Y 1 A GLY 11 ? A GLY 14 117 7 Y 1 A ALA 12 ? A ALA 15 118 7 Y 1 A LYS 13 ? A LYS 16 119 7 Y 1 A LEU 14 ? A LEU 17 120 8 Y 1 A LYS -2 ? A LYS 1 121 8 Y 1 A ALA -1 ? A ALA 2 122 8 Y 1 A GLY 0 ? A GLY 3 123 8 Y 1 A MET 1 ? A MET 4 124 8 Y 1 A ALA 2 ? A ALA 5 125 8 Y 1 A ALA 3 ? A ALA 6 126 8 Y 1 A ALA 4 ? A ALA 7 127 8 Y 1 A ALA 5 ? A ALA 8 128 8 Y 1 A ALA 6 ? A ALA 9 129 8 Y 1 A SER 7 ? A SER 10 130 8 Y 1 A ARG 8 ? A ARG 11 131 8 Y 1 A GLY 9 ? A GLY 12 132 8 Y 1 A VAL 10 ? A VAL 13 133 8 Y 1 A GLY 11 ? A GLY 14 134 8 Y 1 A ALA 12 ? A ALA 15 135 8 Y 1 A LYS 13 ? A LYS 16 136 8 Y 1 A LEU 14 ? A LEU 17 137 9 Y 1 A LYS -2 ? A LYS 1 138 9 Y 1 A ALA -1 ? A ALA 2 139 9 Y 1 A GLY 0 ? A GLY 3 140 9 Y 1 A MET 1 ? A MET 4 141 9 Y 1 A ALA 2 ? A ALA 5 142 9 Y 1 A ALA 3 ? A ALA 6 143 9 Y 1 A ALA 4 ? A ALA 7 144 9 Y 1 A ALA 5 ? A ALA 8 145 9 Y 1 A ALA 6 ? A ALA 9 146 9 Y 1 A SER 7 ? A SER 10 147 9 Y 1 A ARG 8 ? A ARG 11 148 9 Y 1 A GLY 9 ? A GLY 12 149 9 Y 1 A VAL 10 ? A VAL 13 150 9 Y 1 A GLY 11 ? A GLY 14 151 9 Y 1 A ALA 12 ? A ALA 15 152 9 Y 1 A LYS 13 ? A LYS 16 153 9 Y 1 A LEU 14 ? A LEU 17 154 10 Y 1 A LYS -2 ? A LYS 1 155 10 Y 1 A ALA -1 ? A ALA 2 156 10 Y 1 A GLY 0 ? A GLY 3 157 10 Y 1 A MET 1 ? A MET 4 158 10 Y 1 A ALA 2 ? A ALA 5 159 10 Y 1 A ALA 3 ? A ALA 6 160 10 Y 1 A ALA 4 ? A ALA 7 161 10 Y 1 A ALA 5 ? A ALA 8 162 10 Y 1 A ALA 6 ? A ALA 9 163 10 Y 1 A SER 7 ? A SER 10 164 10 Y 1 A ARG 8 ? A ARG 11 165 10 Y 1 A GLY 9 ? A GLY 12 166 10 Y 1 A VAL 10 ? A VAL 13 167 10 Y 1 A GLY 11 ? A GLY 14 168 10 Y 1 A ALA 12 ? A ALA 15 169 10 Y 1 A LYS 13 ? A LYS 16 170 10 Y 1 A LEU 14 ? A LEU 17 171 11 Y 1 A LYS -2 ? A LYS 1 172 11 Y 1 A ALA -1 ? A ALA 2 173 11 Y 1 A GLY 0 ? A GLY 3 174 11 Y 1 A MET 1 ? A MET 4 175 11 Y 1 A ALA 2 ? A ALA 5 176 11 Y 1 A ALA 3 ? A ALA 6 177 11 Y 1 A ALA 4 ? A ALA 7 178 11 Y 1 A ALA 5 ? A ALA 8 179 11 Y 1 A ALA 6 ? A ALA 9 180 11 Y 1 A SER 7 ? A SER 10 181 11 Y 1 A ARG 8 ? A ARG 11 182 11 Y 1 A GLY 9 ? A GLY 12 183 11 Y 1 A VAL 10 ? A VAL 13 184 11 Y 1 A GLY 11 ? A GLY 14 185 11 Y 1 A ALA 12 ? A ALA 15 186 11 Y 1 A LYS 13 ? A LYS 16 187 11 Y 1 A LEU 14 ? A LEU 17 188 12 Y 1 A LYS -2 ? A LYS 1 189 12 Y 1 A ALA -1 ? A ALA 2 190 12 Y 1 A GLY 0 ? A GLY 3 191 12 Y 1 A MET 1 ? A MET 4 192 12 Y 1 A ALA 2 ? A ALA 5 193 12 Y 1 A ALA 3 ? A ALA 6 194 12 Y 1 A ALA 4 ? A ALA 7 195 12 Y 1 A ALA 5 ? A ALA 8 196 12 Y 1 A ALA 6 ? A ALA 9 197 12 Y 1 A SER 7 ? A SER 10 198 12 Y 1 A ARG 8 ? A ARG 11 199 12 Y 1 A GLY 9 ? A GLY 12 200 12 Y 1 A VAL 10 ? A VAL 13 201 12 Y 1 A GLY 11 ? A GLY 14 202 12 Y 1 A ALA 12 ? A ALA 15 203 12 Y 1 A LYS 13 ? A LYS 16 204 12 Y 1 A LEU 14 ? A LEU 17 205 13 Y 1 A LYS -2 ? A LYS 1 206 13 Y 1 A ALA -1 ? A ALA 2 207 13 Y 1 A GLY 0 ? A GLY 3 208 13 Y 1 A MET 1 ? A MET 4 209 13 Y 1 A ALA 2 ? A ALA 5 210 13 Y 1 A ALA 3 ? A ALA 6 211 13 Y 1 A ALA 4 ? A ALA 7 212 13 Y 1 A ALA 5 ? A ALA 8 213 13 Y 1 A ALA 6 ? A ALA 9 214 13 Y 1 A SER 7 ? A SER 10 215 13 Y 1 A ARG 8 ? A ARG 11 216 13 Y 1 A GLY 9 ? A GLY 12 217 13 Y 1 A VAL 10 ? A VAL 13 218 13 Y 1 A GLY 11 ? A GLY 14 219 13 Y 1 A ALA 12 ? A ALA 15 220 13 Y 1 A LYS 13 ? A LYS 16 221 13 Y 1 A LEU 14 ? A LEU 17 222 14 Y 1 A LYS -2 ? A LYS 1 223 14 Y 1 A ALA -1 ? A ALA 2 224 14 Y 1 A GLY 0 ? A GLY 3 225 14 Y 1 A MET 1 ? A MET 4 226 14 Y 1 A ALA 2 ? A ALA 5 227 14 Y 1 A ALA 3 ? A ALA 6 228 14 Y 1 A ALA 4 ? A ALA 7 229 14 Y 1 A ALA 5 ? A ALA 8 230 14 Y 1 A ALA 6 ? A ALA 9 231 14 Y 1 A SER 7 ? A SER 10 232 14 Y 1 A ARG 8 ? A ARG 11 233 14 Y 1 A GLY 9 ? A GLY 12 234 14 Y 1 A VAL 10 ? A VAL 13 235 14 Y 1 A GLY 11 ? A GLY 14 236 14 Y 1 A ALA 12 ? A ALA 15 237 14 Y 1 A LYS 13 ? A LYS 16 238 14 Y 1 A LEU 14 ? A LEU 17 239 15 Y 1 A LYS -2 ? A LYS 1 240 15 Y 1 A ALA -1 ? A ALA 2 241 15 Y 1 A GLY 0 ? A GLY 3 242 15 Y 1 A MET 1 ? A MET 4 243 15 Y 1 A ALA 2 ? A ALA 5 244 15 Y 1 A ALA 3 ? A ALA 6 245 15 Y 1 A ALA 4 ? A ALA 7 246 15 Y 1 A ALA 5 ? A ALA 8 247 15 Y 1 A ALA 6 ? A ALA 9 248 15 Y 1 A SER 7 ? A SER 10 249 15 Y 1 A ARG 8 ? A ARG 11 250 15 Y 1 A GLY 9 ? A GLY 12 251 15 Y 1 A VAL 10 ? A VAL 13 252 15 Y 1 A GLY 11 ? A GLY 14 253 15 Y 1 A ALA 12 ? A ALA 15 254 15 Y 1 A LYS 13 ? A LYS 16 255 15 Y 1 A LEU 14 ? A LEU 17 256 16 Y 1 A LYS -2 ? A LYS 1 257 16 Y 1 A ALA -1 ? A ALA 2 258 16 Y 1 A GLY 0 ? A GLY 3 259 16 Y 1 A MET 1 ? A MET 4 260 16 Y 1 A ALA 2 ? A ALA 5 261 16 Y 1 A ALA 3 ? A ALA 6 262 16 Y 1 A ALA 4 ? A ALA 7 263 16 Y 1 A ALA 5 ? A ALA 8 264 16 Y 1 A ALA 6 ? A ALA 9 265 16 Y 1 A SER 7 ? A SER 10 266 16 Y 1 A ARG 8 ? A ARG 11 267 16 Y 1 A GLY 9 ? A GLY 12 268 16 Y 1 A VAL 10 ? A VAL 13 269 16 Y 1 A GLY 11 ? A GLY 14 270 16 Y 1 A ALA 12 ? A ALA 15 271 16 Y 1 A LYS 13 ? A LYS 16 272 16 Y 1 A LEU 14 ? A LEU 17 273 17 Y 1 A LYS -2 ? A LYS 1 274 17 Y 1 A ALA -1 ? A ALA 2 275 17 Y 1 A GLY 0 ? A GLY 3 276 17 Y 1 A MET 1 ? A MET 4 277 17 Y 1 A ALA 2 ? A ALA 5 278 17 Y 1 A ALA 3 ? A ALA 6 279 17 Y 1 A ALA 4 ? A ALA 7 280 17 Y 1 A ALA 5 ? A ALA 8 281 17 Y 1 A ALA 6 ? A ALA 9 282 17 Y 1 A SER 7 ? A SER 10 283 17 Y 1 A ARG 8 ? A ARG 11 284 17 Y 1 A GLY 9 ? A GLY 12 285 17 Y 1 A VAL 10 ? A VAL 13 286 17 Y 1 A GLY 11 ? A GLY 14 287 17 Y 1 A ALA 12 ? A ALA 15 288 17 Y 1 A LYS 13 ? A LYS 16 289 17 Y 1 A LEU 14 ? A LEU 17 290 18 Y 1 A LYS -2 ? A LYS 1 291 18 Y 1 A ALA -1 ? A ALA 2 292 18 Y 1 A GLY 0 ? A GLY 3 293 18 Y 1 A MET 1 ? A MET 4 294 18 Y 1 A ALA 2 ? A ALA 5 295 18 Y 1 A ALA 3 ? A ALA 6 296 18 Y 1 A ALA 4 ? A ALA 7 297 18 Y 1 A ALA 5 ? A ALA 8 298 18 Y 1 A ALA 6 ? A ALA 9 299 18 Y 1 A SER 7 ? A SER 10 300 18 Y 1 A ARG 8 ? A ARG 11 301 18 Y 1 A GLY 9 ? A GLY 12 302 18 Y 1 A VAL 10 ? A VAL 13 303 18 Y 1 A GLY 11 ? A GLY 14 304 18 Y 1 A ALA 12 ? A ALA 15 305 18 Y 1 A LYS 13 ? A LYS 16 306 18 Y 1 A LEU 14 ? A LEU 17 307 19 Y 1 A LYS -2 ? A LYS 1 308 19 Y 1 A ALA -1 ? A ALA 2 309 19 Y 1 A GLY 0 ? A GLY 3 310 19 Y 1 A MET 1 ? A MET 4 311 19 Y 1 A ALA 2 ? A ALA 5 312 19 Y 1 A ALA 3 ? A ALA 6 313 19 Y 1 A ALA 4 ? A ALA 7 314 19 Y 1 A ALA 5 ? A ALA 8 315 19 Y 1 A ALA 6 ? A ALA 9 316 19 Y 1 A SER 7 ? A SER 10 317 19 Y 1 A ARG 8 ? A ARG 11 318 19 Y 1 A GLY 9 ? A GLY 12 319 19 Y 1 A VAL 10 ? A VAL 13 320 19 Y 1 A GLY 11 ? A GLY 14 321 19 Y 1 A ALA 12 ? A ALA 15 322 19 Y 1 A LYS 13 ? A LYS 16 323 19 Y 1 A LEU 14 ? A LEU 17 #