data_1S62 # _entry.id 1S62 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1S62 pdb_00001s62 10.2210/pdb1s62/pdb RCSB RCSB021412 ? ? WWPDB D_1000021412 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 4771 _pdbx_database_related.details 'Assignment of the 1H, 15N and 13C resonances of the same protein, used to calculate its structure' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1S62 _pdbx_database_status.recvd_initial_deposition_date 2004-01-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Deprez, C.' 1 'Blanchard, L.' 2 'Simorre, J.-P.' 3 'Gavioli, M.' 4 'Guerlesquin, F.' 5 'Lazdunski, C.' 6 'Lloubes, R.' 7 'Marion, D.' 8 # _citation.id primary _citation.title ;Solution structure of the E.coli TolA C-terminal domain reveals conformational changes upon binding to the phage g3p N-terminal domain. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 346 _citation.page_first 1047 _citation.page_last 1057 _citation.year 2005 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15701516 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2004.12.028 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Deprez, C.' 1 ? primary 'Lloubes, R.' 2 ? primary 'Gavioli, M.' 3 ? primary 'Marion, D.' 4 ? primary 'Guerlesquin, F.' 5 ? primary 'Blanchard, L.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TolA protein' _entity.formula_weight 11329.827 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-terminal domain (residues 325-421)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AEFGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIP KPPSQAVYEVFKNAPLDFKPHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;AEFGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIP KPPSQAVYEVFKNAPLDFKPHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 PHE n 1 4 GLY n 1 5 ASN n 1 6 THR n 1 7 LYS n 1 8 ASN n 1 9 ASN n 1 10 GLY n 1 11 ALA n 1 12 SER n 1 13 GLY n 1 14 ALA n 1 15 ASP n 1 16 ILE n 1 17 ASN n 1 18 ASN n 1 19 TYR n 1 20 ALA n 1 21 GLY n 1 22 GLN n 1 23 ILE n 1 24 LYS n 1 25 SER n 1 26 ALA n 1 27 ILE n 1 28 GLU n 1 29 SER n 1 30 LYS n 1 31 PHE n 1 32 TYR n 1 33 ASP n 1 34 ALA n 1 35 SER n 1 36 SER n 1 37 TYR n 1 38 ALA n 1 39 GLY n 1 40 LYS n 1 41 THR n 1 42 CYS n 1 43 THR n 1 44 LEU n 1 45 ARG n 1 46 ILE n 1 47 LYS n 1 48 LEU n 1 49 ALA n 1 50 PRO n 1 51 ASP n 1 52 GLY n 1 53 MET n 1 54 LEU n 1 55 LEU n 1 56 ASP n 1 57 ILE n 1 58 LYS n 1 59 PRO n 1 60 GLU n 1 61 GLY n 1 62 GLY n 1 63 ASP n 1 64 PRO n 1 65 ALA n 1 66 LEU n 1 67 CYS n 1 68 GLN n 1 69 ALA n 1 70 ALA n 1 71 LEU n 1 72 ALA n 1 73 ALA n 1 74 ALA n 1 75 LYS n 1 76 LEU n 1 77 ALA n 1 78 LYS n 1 79 ILE n 1 80 PRO n 1 81 LYS n 1 82 PRO n 1 83 PRO n 1 84 SER n 1 85 GLN n 1 86 ALA n 1 87 VAL n 1 88 TYR n 1 89 GLU n 1 90 VAL n 1 91 PHE n 1 92 LYS n 1 93 ASN n 1 94 ALA n 1 95 PRO n 1 96 LEU n 1 97 ASP n 1 98 PHE n 1 99 LYS n 1 100 PRO n 1 101 HIS n 1 102 HIS n 1 103 HIS n 1 104 HIS n 1 105 HIS n 1 106 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene 'TOLA, CIM, EXCC, LKY, B0739' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli str. K12 substr. W3110' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 316407 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain W3110 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTolAIII3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TOLA_ECOLI _struct_ref.pdbx_db_accession P19934 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPP SQAVYEVFKNAPLDFKP ; _struct_ref.pdbx_align_begin 325 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1S62 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 100 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19934 _struct_ref_seq.db_align_beg 325 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 421 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 100 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1S62 ALA A 1 ? UNP P19934 ? ? 'cloning artifact' 1 1 1 1S62 GLU A 2 ? UNP P19934 ? ? 'cloning artifact' 2 2 1 1S62 PHE A 3 ? UNP P19934 ? ? 'cloning artifact' 3 3 1 1S62 HIS A 101 ? UNP P19934 ? ? 'expression tag' 101 4 1 1S62 HIS A 102 ? UNP P19934 ? ? 'expression tag' 102 5 1 1S62 HIS A 103 ? UNP P19934 ? ? 'expression tag' 103 6 1 1S62 HIS A 104 ? UNP P19934 ? ? 'expression tag' 104 7 1 1S62 HIS A 105 ? UNP P19934 ? ? 'expression tag' 105 8 1 1S62 HIS A 106 ? UNP P19934 ? ? 'expression tag' 106 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 2 3D_13C-separated_NOESY 3 3 3 3D_15N-separated_NOESY # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 ambient 6.8 '100mN NaCl, 50mM NaPO4' ? K 2 300 ambient 6.8 '50mN NaCl, 50mM NaPO4' ? K 3 300 ambient 6.8 '500mN NaCl, 50mM NaPO4' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.4mM U-15N, 100mN NaCl, 50mM NaPO4, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '0.5mM U-15N,13C, 50mN NaCl, 50mM NaPO4, Complete protease inhibitor (Boehringer), 90% H2O, 10% D2O' '90% H2O/10% D2O' 3 '0.7mM U-15N, 500mN NaCl, 50mM NaPO4, 90% H2O, 10% D2O' '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_refine.entry_id 1S62 _pdbx_nmr_refine.method ;2 step simulated annealing torsion angle dynamics ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1S62 _pdbx_nmr_details.text 'NOE mixing time of 0.08 s, triple-resonance probe including shielded z-gradients' # _pdbx_nmr_ensemble.entry_id 1S62 _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 16 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1S62 _pdbx_nmr_representative.conformer_id 3 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR ? collection varian 1 Felix 2000 processing Accelrys 2 Felix 2000 'data analysis' Accelrys 3 ARIA 1.0 'structure solution' Nilges 4 TALOS ? 'structure solution' Cornilescu 5 TALOS ? refinement Cornilescu 6 # _exptl.entry_id 1S62 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1S62 _struct.title 'Solution structure of the Escherichia coli TolA C-terminal domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1S62 _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text 'tol g3p interaction, PROTEIN TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 13 ? SER A 29 ? GLY A 13 SER A 29 1 ? 17 HELX_P HELX_P2 2 ASP A 63 ? LEU A 76 ? ASP A 63 LEU A 76 1 ? 14 HELX_P HELX_P3 3 SER A 84 ? LYS A 92 ? SER A 84 LYS A 92 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 42 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 67 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 42 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 67 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.031 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 44 ? LEU A 48 ? LEU A 44 LEU A 48 A 2 LEU A 54 ? PRO A 59 ? LEU A 54 PRO A 59 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 45 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 45 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 58 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 58 # _database_PDB_matrix.entry_id 1S62 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1S62 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 HIS 103 103 ? ? ? A . n A 1 104 HIS 104 104 ? ? ? A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-02-15 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 47 ? ? OD2 A ASP 56 ? ? 1.59 2 1 HZ3 A LYS 40 ? ? OD2 A ASP 63 ? ? 1.59 3 3 OD1 A ASP 56 ? ? HZ1 A LYS 58 ? ? 1.59 4 4 HA A ARG 45 ? ? HB3 A PRO 95 ? ? 1.34 5 5 HB2 A SER 35 ? ? HZ A PHE 98 ? ? 1.22 6 5 HB3 A TYR 37 ? ? H A ALA 38 ? ? 1.34 7 6 HB3 A ALA 38 ? ? H A GLY 39 ? ? 1.34 8 6 OD1 A ASP 51 ? ? HZ2 A LYS 81 ? ? 1.59 9 8 OD2 A ASP 97 ? ? HZ1 A LYS 99 ? ? 1.59 10 9 HZ2 A LYS 40 ? ? OD2 A ASP 63 ? ? 1.58 11 10 HZ1 A LYS 47 ? ? OD2 A ASP 56 ? ? 1.55 12 11 HZ3 A LYS 58 ? ? OE2 A GLU 60 ? ? 1.58 13 12 OE2 A GLU 89 ? ? HZ1 A LYS 92 ? ? 1.58 14 13 HZ3 A LYS 40 ? ? OD2 A ASP 63 ? ? 1.56 15 13 OD2 A ASP 97 ? ? HZ1 A LYS 99 ? ? 1.58 16 13 HZ1 A LYS 24 ? ? OE2 A GLU 28 ? ? 1.59 17 16 HB1 A ALA 11 ? ? H A SER 12 ? ? 1.31 18 16 OD2 A ASP 97 ? ? HZ3 A LYS 99 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 3 ? ? 67.81 174.78 2 1 LYS A 7 ? ? -144.23 -68.58 3 1 ASN A 8 ? ? -153.42 65.78 4 1 ALA A 11 ? ? -165.67 23.25 5 1 PHE A 31 ? ? -122.71 -64.73 6 1 TYR A 32 ? ? 161.44 -154.87 7 1 TYR A 37 ? ? -86.41 -142.63 8 1 PRO A 83 ? ? -92.14 -75.57 9 1 ASN A 93 ? ? -164.38 59.94 10 1 PRO A 100 ? ? -37.27 119.94 11 2 PHE A 3 ? ? -106.83 49.04 12 2 THR A 6 ? ? 65.93 77.66 13 2 LYS A 7 ? ? -90.78 36.67 14 2 ASN A 9 ? ? -163.75 95.20 15 2 SER A 36 ? ? -87.97 49.12 16 2 ALA A 38 ? ? 72.26 173.56 17 2 PRO A 82 ? ? -39.17 104.62 18 2 ASN A 93 ? ? -164.93 67.69 19 3 ASN A 5 ? ? 70.29 -60.65 20 3 LYS A 7 ? ? 62.98 80.36 21 3 ASN A 8 ? ? 72.63 -70.62 22 3 ALA A 14 ? ? -105.95 -67.50 23 3 SER A 29 ? ? -76.90 24.48 24 3 LYS A 30 ? ? -133.34 -33.39 25 3 TYR A 32 ? ? 62.02 -121.13 26 3 TYR A 37 ? ? -92.56 -93.84 27 3 PRO A 50 ? ? -63.88 0.81 28 3 ASN A 93 ? ? -158.11 74.82 29 3 PRO A 100 ? ? -53.50 97.66 30 4 PHE A 3 ? ? -110.14 -103.36 31 4 SER A 36 ? ? 71.36 -46.27 32 4 PRO A 83 ? ? -79.38 -75.50 33 4 ASN A 93 ? ? -151.87 38.47 34 4 PRO A 100 ? ? -53.55 107.38 35 4 HIS A 101 ? ? -68.20 95.67 36 5 ASN A 8 ? ? 74.81 100.68 37 5 SER A 12 ? ? 54.94 -95.47 38 5 TYR A 32 ? ? -47.49 90.60 39 5 ASP A 33 ? ? 53.24 17.64 40 5 TYR A 37 ? ? -81.76 -117.78 41 5 ALA A 38 ? ? -172.68 147.36 42 5 ASN A 93 ? ? -173.74 34.64 43 5 PRO A 100 ? ? -31.61 119.64 44 6 GLU A 2 ? ? 62.62 94.14 45 6 LYS A 7 ? ? -97.93 57.86 46 6 LYS A 30 ? ? -148.89 33.30 47 6 TYR A 32 ? ? 71.10 -72.24 48 6 ASP A 33 ? ? -149.84 24.94 49 6 SER A 36 ? ? -109.46 -73.27 50 6 TYR A 37 ? ? 37.23 -107.57 51 6 ALA A 38 ? ? -154.56 -119.32 52 6 PHE A 91 ? ? -83.69 41.83 53 6 ASN A 93 ? ? -158.98 59.89 54 6 PRO A 100 ? ? -45.45 107.03 55 7 GLU A 2 ? ? -127.19 -83.27 56 7 ASN A 5 ? ? 71.97 -47.33 57 7 LYS A 7 ? ? 71.46 -63.05 58 7 ASN A 8 ? ? -154.67 -52.11 59 7 ASN A 9 ? ? 67.15 -67.95 60 7 ASP A 15 ? ? -167.22 -49.08 61 7 TYR A 32 ? ? -74.43 -77.08 62 7 TYR A 37 ? ? -83.15 43.48 63 7 ALA A 38 ? ? -67.80 67.38 64 7 PRO A 82 ? ? -34.64 99.68 65 7 ASN A 93 ? ? -160.09 72.53 66 7 PRO A 100 ? ? -46.03 100.07 67 8 ASN A 9 ? ? -83.56 -101.19 68 8 ALA A 11 ? ? -167.96 -98.07 69 8 SER A 36 ? ? 74.58 -47.39 70 8 GLU A 60 ? ? -98.36 -70.56 71 8 ASN A 93 ? ? -161.58 77.84 72 8 PRO A 100 ? ? -57.95 104.28 73 9 ASN A 5 ? ? -151.66 -128.33 74 9 THR A 6 ? ? 53.91 -97.42 75 9 LYS A 7 ? ? 74.09 -58.60 76 9 ASP A 15 ? ? 72.68 -47.93 77 9 TYR A 32 ? ? -115.40 -75.94 78 9 SER A 36 ? ? -97.61 45.61 79 9 CYS A 42 ? ? -152.89 57.64 80 9 ASN A 93 ? ? -162.19 50.92 81 10 PHE A 3 ? ? 69.25 -57.95 82 10 ALA A 14 ? ? 76.39 -32.39 83 10 TYR A 32 ? ? -68.29 -90.77 84 10 SER A 36 ? ? -68.09 95.58 85 10 TYR A 37 ? ? -123.26 -68.51 86 10 ALA A 38 ? ? -174.80 -160.15 87 10 CYS A 42 ? ? -163.56 90.33 88 10 ASN A 93 ? ? -163.62 78.22 89 10 PRO A 100 ? ? -53.23 109.45 90 11 PHE A 3 ? ? 74.60 -47.14 91 11 ASN A 9 ? ? -142.90 17.43 92 11 LYS A 30 ? ? -151.40 33.48 93 11 TYR A 32 ? ? 67.77 -70.10 94 11 GLU A 60 ? ? -90.28 -65.77 95 11 ASN A 93 ? ? -169.20 69.46 96 12 ASN A 9 ? ? -146.36 -88.14 97 12 ALA A 14 ? ? 62.42 -89.85 98 12 PHE A 31 ? ? -104.97 69.70 99 12 ASP A 33 ? ? 64.01 -1.25 100 12 TYR A 37 ? ? -96.38 -144.17 101 12 PRO A 50 ? ? -58.28 -6.94 102 12 ASN A 93 ? ? -169.21 22.16 103 12 PRO A 100 ? ? -40.07 106.62 104 13 GLU A 2 ? ? 70.27 -57.91 105 13 ASN A 5 ? ? -80.33 48.17 106 13 LYS A 7 ? ? 56.95 -137.75 107 13 ALA A 14 ? ? -129.67 -55.13 108 13 TYR A 32 ? ? -85.60 -83.81 109 13 ASN A 93 ? ? -153.08 46.78 110 13 PRO A 100 ? ? -36.19 126.04 111 14 GLU A 2 ? ? 70.51 -64.36 112 14 ASN A 5 ? ? 54.22 76.16 113 14 TYR A 32 ? ? -60.56 86.52 114 14 ALA A 38 ? ? 68.62 152.52 115 14 ASN A 93 ? ? -154.87 55.37 116 14 PRO A 100 ? ? -36.06 114.50 117 15 PHE A 3 ? ? -80.93 46.72 118 15 THR A 6 ? ? -67.98 84.92 119 15 LYS A 7 ? ? -164.39 -77.70 120 15 ASP A 15 ? ? 65.22 -71.20 121 15 LYS A 30 ? ? -150.81 32.14 122 15 TYR A 32 ? ? 69.83 -66.38 123 15 ASP A 33 ? ? -149.70 25.34 124 15 TYR A 37 ? ? -110.64 -154.12 125 15 ALA A 38 ? ? 73.33 118.59 126 15 GLU A 60 ? ? -98.98 -76.58 127 15 ASN A 93 ? ? -158.30 76.08 128 15 PRO A 100 ? ? -33.23 118.72 129 16 PHE A 3 ? ? 68.74 -75.79 130 16 ASN A 5 ? ? -118.11 75.45 131 16 THR A 6 ? ? 61.92 112.69 132 16 ALA A 11 ? ? -171.92 -114.01 133 16 TYR A 32 ? ? 66.77 75.84 134 16 TYR A 37 ? ? -88.36 -157.27 135 16 PRO A 82 ? ? -56.04 106.92 136 16 ASN A 93 ? ? -170.07 75.15 137 16 PRO A 100 ? ? -60.45 90.44 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id TYR _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 32 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -10.70 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 103 ? A HIS 103 2 1 Y 1 A HIS 104 ? A HIS 104 3 1 Y 1 A HIS 105 ? A HIS 105 4 1 Y 1 A HIS 106 ? A HIS 106 5 2 Y 1 A HIS 103 ? A HIS 103 6 2 Y 1 A HIS 104 ? A HIS 104 7 2 Y 1 A HIS 105 ? A HIS 105 8 2 Y 1 A HIS 106 ? A HIS 106 9 3 Y 1 A HIS 103 ? A HIS 103 10 3 Y 1 A HIS 104 ? A HIS 104 11 3 Y 1 A HIS 105 ? A HIS 105 12 3 Y 1 A HIS 106 ? A HIS 106 13 4 Y 1 A HIS 103 ? A HIS 103 14 4 Y 1 A HIS 104 ? A HIS 104 15 4 Y 1 A HIS 105 ? A HIS 105 16 4 Y 1 A HIS 106 ? A HIS 106 17 5 Y 1 A HIS 103 ? A HIS 103 18 5 Y 1 A HIS 104 ? A HIS 104 19 5 Y 1 A HIS 105 ? A HIS 105 20 5 Y 1 A HIS 106 ? A HIS 106 21 6 Y 1 A HIS 103 ? A HIS 103 22 6 Y 1 A HIS 104 ? A HIS 104 23 6 Y 1 A HIS 105 ? A HIS 105 24 6 Y 1 A HIS 106 ? A HIS 106 25 7 Y 1 A HIS 103 ? A HIS 103 26 7 Y 1 A HIS 104 ? A HIS 104 27 7 Y 1 A HIS 105 ? A HIS 105 28 7 Y 1 A HIS 106 ? A HIS 106 29 8 Y 1 A HIS 103 ? A HIS 103 30 8 Y 1 A HIS 104 ? A HIS 104 31 8 Y 1 A HIS 105 ? A HIS 105 32 8 Y 1 A HIS 106 ? A HIS 106 33 9 Y 1 A HIS 103 ? A HIS 103 34 9 Y 1 A HIS 104 ? A HIS 104 35 9 Y 1 A HIS 105 ? A HIS 105 36 9 Y 1 A HIS 106 ? A HIS 106 37 10 Y 1 A HIS 103 ? A HIS 103 38 10 Y 1 A HIS 104 ? A HIS 104 39 10 Y 1 A HIS 105 ? A HIS 105 40 10 Y 1 A HIS 106 ? A HIS 106 41 11 Y 1 A HIS 103 ? A HIS 103 42 11 Y 1 A HIS 104 ? A HIS 104 43 11 Y 1 A HIS 105 ? A HIS 105 44 11 Y 1 A HIS 106 ? A HIS 106 45 12 Y 1 A HIS 103 ? A HIS 103 46 12 Y 1 A HIS 104 ? A HIS 104 47 12 Y 1 A HIS 105 ? A HIS 105 48 12 Y 1 A HIS 106 ? A HIS 106 49 13 Y 1 A HIS 103 ? A HIS 103 50 13 Y 1 A HIS 104 ? A HIS 104 51 13 Y 1 A HIS 105 ? A HIS 105 52 13 Y 1 A HIS 106 ? A HIS 106 53 14 Y 1 A HIS 103 ? A HIS 103 54 14 Y 1 A HIS 104 ? A HIS 104 55 14 Y 1 A HIS 105 ? A HIS 105 56 14 Y 1 A HIS 106 ? A HIS 106 57 15 Y 1 A HIS 103 ? A HIS 103 58 15 Y 1 A HIS 104 ? A HIS 104 59 15 Y 1 A HIS 105 ? A HIS 105 60 15 Y 1 A HIS 106 ? A HIS 106 61 16 Y 1 A HIS 103 ? A HIS 103 62 16 Y 1 A HIS 104 ? A HIS 104 63 16 Y 1 A HIS 105 ? A HIS 105 64 16 Y 1 A HIS 106 ? A HIS 106 #