data_1S62
# 
_entry.id   1S62 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.399 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1S62         pdb_00001s62 10.2210/pdb1s62/pdb 
RCSB  RCSB021412   ?            ?                   
WWPDB D_1000021412 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-02-15 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
5 'Structure model' 1 4 2024-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2                
2 4 'Structure model' pdbx_nmr_software         
3 4 'Structure model' pdbx_struct_assembly      
4 4 'Structure model' pdbx_struct_oper_list     
5 4 'Structure model' struct_ref_seq_dif        
6 5 'Structure model' chem_comp_atom            
7 5 'Structure model' chem_comp_bond            
8 5 'Structure model' pdbx_entry_details        
9 5 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
4 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S62 
_pdbx_database_status.recvd_initial_deposition_date   2004-01-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          4771 
_pdbx_database_related.details        
'Assignment of the 1H, 15N and 13C resonances of the same protein, used to calculate its structure' 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Deprez, C.'      1 
'Blanchard, L.'   2 
'Simorre, J.-P.'  3 
'Gavioli, M.'     4 
'Guerlesquin, F.' 5 
'Lazdunski, C.'   6 
'Lloubes, R.'     7 
'Marion, D.'      8 
# 
_citation.id                        primary 
_citation.title                     
;Solution structure of the E.coli TolA C-terminal domain reveals conformational changes upon binding to the phage g3p N-terminal domain.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            346 
_citation.page_first                1047 
_citation.page_last                 1057 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15701516 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.12.028 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Deprez, C.'      1 ? 
primary 'Lloubes, R.'     2 ? 
primary 'Gavioli, M.'     3 ? 
primary 'Marion, D.'      4 ? 
primary 'Guerlesquin, F.' 5 ? 
primary 'Blanchard, L.'   6 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'TolA protein' 
_entity.formula_weight             11329.827 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'C-terminal domain (residues 325-421)' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AEFGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIP
KPPSQAVYEVFKNAPLDFKPHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AEFGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIP
KPPSQAVYEVFKNAPLDFKPHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   GLU n 
1 3   PHE n 
1 4   GLY n 
1 5   ASN n 
1 6   THR n 
1 7   LYS n 
1 8   ASN n 
1 9   ASN n 
1 10  GLY n 
1 11  ALA n 
1 12  SER n 
1 13  GLY n 
1 14  ALA n 
1 15  ASP n 
1 16  ILE n 
1 17  ASN n 
1 18  ASN n 
1 19  TYR n 
1 20  ALA n 
1 21  GLY n 
1 22  GLN n 
1 23  ILE n 
1 24  LYS n 
1 25  SER n 
1 26  ALA n 
1 27  ILE n 
1 28  GLU n 
1 29  SER n 
1 30  LYS n 
1 31  PHE n 
1 32  TYR n 
1 33  ASP n 
1 34  ALA n 
1 35  SER n 
1 36  SER n 
1 37  TYR n 
1 38  ALA n 
1 39  GLY n 
1 40  LYS n 
1 41  THR n 
1 42  CYS n 
1 43  THR n 
1 44  LEU n 
1 45  ARG n 
1 46  ILE n 
1 47  LYS n 
1 48  LEU n 
1 49  ALA n 
1 50  PRO n 
1 51  ASP n 
1 52  GLY n 
1 53  MET n 
1 54  LEU n 
1 55  LEU n 
1 56  ASP n 
1 57  ILE n 
1 58  LYS n 
1 59  PRO n 
1 60  GLU n 
1 61  GLY n 
1 62  GLY n 
1 63  ASP n 
1 64  PRO n 
1 65  ALA n 
1 66  LEU n 
1 67  CYS n 
1 68  GLN n 
1 69  ALA n 
1 70  ALA n 
1 71  LEU n 
1 72  ALA n 
1 73  ALA n 
1 74  ALA n 
1 75  LYS n 
1 76  LEU n 
1 77  ALA n 
1 78  LYS n 
1 79  ILE n 
1 80  PRO n 
1 81  LYS n 
1 82  PRO n 
1 83  PRO n 
1 84  SER n 
1 85  GLN n 
1 86  ALA n 
1 87  VAL n 
1 88  TYR n 
1 89  GLU n 
1 90  VAL n 
1 91  PHE n 
1 92  LYS n 
1 93  ASN n 
1 94  ALA n 
1 95  PRO n 
1 96  LEU n 
1 97  ASP n 
1 98  PHE n 
1 99  LYS n 
1 100 PRO n 
1 101 HIS n 
1 102 HIS n 
1 103 HIS n 
1 104 HIS n 
1 105 HIS n 
1 106 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'TOLA, CIM, EXCC, LKY, B0739' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli str. K12 substr. W3110' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     316407 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               W3110 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTolAIII3 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   ASN 5   5   5   ASN ASN A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  TYR 32  32  32  TYR TYR A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  CYS 42  42  42  CYS CYS A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  MET 53  53  53  MET MET A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 HIS 102 102 102 HIS HIS A . n 
A 1 103 HIS 103 103 ?   ?   ?   A . n 
A 1 104 HIS 104 104 ?   ?   ?   A . n 
A 1 105 HIS 105 105 ?   ?   ?   A . n 
A 1 106 HIS 106 106 ?   ?   ?   A . n 
# 
_exptl.entry_id          1S62 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1S62 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1S62 
_struct.title                     'Solution structure of the Escherichia coli TolA C-terminal domain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S62 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            'tol g3p interaction, PROTEIN TRANSPORT' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TOLA_ECOLI 
_struct_ref.pdbx_db_accession          P19934 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPP
SQAVYEVFKNAPLDFKP
;
_struct_ref.pdbx_align_begin           325 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1S62 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 100 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P19934 
_struct_ref_seq.db_align_beg                  325 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  421 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       100 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1S62 ALA A 1   ? UNP P19934 ? ? 'cloning artifact' 1   1 
1 1S62 GLU A 2   ? UNP P19934 ? ? 'cloning artifact' 2   2 
1 1S62 PHE A 3   ? UNP P19934 ? ? 'cloning artifact' 3   3 
1 1S62 HIS A 101 ? UNP P19934 ? ? 'expression tag'   101 4 
1 1S62 HIS A 102 ? UNP P19934 ? ? 'expression tag'   102 5 
1 1S62 HIS A 103 ? UNP P19934 ? ? 'expression tag'   103 6 
1 1S62 HIS A 104 ? UNP P19934 ? ? 'expression tag'   104 7 
1 1S62 HIS A 105 ? UNP P19934 ? ? 'expression tag'   105 8 
1 1S62 HIS A 106 ? UNP P19934 ? ? 'expression tag'   106 9 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 13 ? SER A 29 ? GLY A 13 SER A 29 1 ? 17 
HELX_P HELX_P2 2 ASP A 63 ? LEU A 76 ? ASP A 63 LEU A 76 1 ? 14 
HELX_P HELX_P3 3 SER A 84 ? LYS A 92 ? SER A 84 LYS A 92 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            42 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            67 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             42 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             67 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.031 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      CYS 
_pdbx_modification_feature.label_asym_id                      A 
_pdbx_modification_feature.label_seq_id                       42 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     CYS 
_pdbx_modification_feature.modified_residue_label_asym_id     A 
_pdbx_modification_feature.modified_residue_label_seq_id      67 
_pdbx_modification_feature.modified_residue_label_alt_id      ? 
_pdbx_modification_feature.auth_comp_id                       CYS 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        42 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      CYS 
_pdbx_modification_feature.modified_residue_auth_asym_id      A 
_pdbx_modification_feature.modified_residue_auth_seq_id       67 
_pdbx_modification_feature.modified_residue_PDB_ins_code      ? 
_pdbx_modification_feature.modified_residue_symmetry          1_555 
_pdbx_modification_feature.comp_id_linking_atom               SG 
_pdbx_modification_feature.modified_residue_id_linking_atom   SG 
_pdbx_modification_feature.modified_residue_id                . 
_pdbx_modification_feature.ref_pcm_id                         . 
_pdbx_modification_feature.ref_comp_id                        . 
_pdbx_modification_feature.type                               None 
_pdbx_modification_feature.category                           'Disulfide bridge' 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 44 ? LEU A 48 ? LEU A 44 LEU A 48 
A 2 LEU A 54 ? PRO A 59 ? LEU A 54 PRO A 59 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ARG 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    45 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ARG 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     45 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   LYS 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    58 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    LYS 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     58 
# 
_pdbx_entry_details.entry_id                   1S62 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  HZ2 A LYS 47 ? ? OD2 A ASP 56 ? ? 1.59 
2  1  HZ3 A LYS 40 ? ? OD2 A ASP 63 ? ? 1.59 
3  3  OD1 A ASP 56 ? ? HZ1 A LYS 58 ? ? 1.59 
4  4  HA  A ARG 45 ? ? HB3 A PRO 95 ? ? 1.34 
5  5  HB2 A SER 35 ? ? HZ  A PHE 98 ? ? 1.22 
6  5  HB3 A TYR 37 ? ? H   A ALA 38 ? ? 1.34 
7  6  HB3 A ALA 38 ? ? H   A GLY 39 ? ? 1.34 
8  6  OD1 A ASP 51 ? ? HZ2 A LYS 81 ? ? 1.59 
9  8  OD2 A ASP 97 ? ? HZ1 A LYS 99 ? ? 1.59 
10 9  HZ2 A LYS 40 ? ? OD2 A ASP 63 ? ? 1.58 
11 10 HZ1 A LYS 47 ? ? OD2 A ASP 56 ? ? 1.55 
12 11 HZ3 A LYS 58 ? ? OE2 A GLU 60 ? ? 1.58 
13 12 OE2 A GLU 89 ? ? HZ1 A LYS 92 ? ? 1.58 
14 13 HZ3 A LYS 40 ? ? OD2 A ASP 63 ? ? 1.56 
15 13 OD2 A ASP 97 ? ? HZ1 A LYS 99 ? ? 1.58 
16 13 HZ1 A LYS 24 ? ? OE2 A GLU 28 ? ? 1.59 
17 16 HB1 A ALA 11 ? ? H   A SER 12 ? ? 1.31 
18 16 OD2 A ASP 97 ? ? HZ3 A LYS 99 ? ? 1.57 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  PHE A 3   ? ? 67.81   174.78  
2   1  LYS A 7   ? ? -144.23 -68.58  
3   1  ASN A 8   ? ? -153.42 65.78   
4   1  ALA A 11  ? ? -165.67 23.25   
5   1  PHE A 31  ? ? -122.71 -64.73  
6   1  TYR A 32  ? ? 161.44  -154.87 
7   1  TYR A 37  ? ? -86.41  -142.63 
8   1  PRO A 83  ? ? -92.14  -75.57  
9   1  ASN A 93  ? ? -164.38 59.94   
10  1  PRO A 100 ? ? -37.27  119.94  
11  2  PHE A 3   ? ? -106.83 49.04   
12  2  THR A 6   ? ? 65.93   77.66   
13  2  LYS A 7   ? ? -90.78  36.67   
14  2  ASN A 9   ? ? -163.75 95.20   
15  2  SER A 36  ? ? -87.97  49.12   
16  2  ALA A 38  ? ? 72.26   173.56  
17  2  PRO A 82  ? ? -39.17  104.62  
18  2  ASN A 93  ? ? -164.93 67.69   
19  3  ASN A 5   ? ? 70.29   -60.65  
20  3  LYS A 7   ? ? 62.98   80.36   
21  3  ASN A 8   ? ? 72.63   -70.62  
22  3  ALA A 14  ? ? -105.95 -67.50  
23  3  SER A 29  ? ? -76.90  24.48   
24  3  LYS A 30  ? ? -133.34 -33.39  
25  3  TYR A 32  ? ? 62.02   -121.13 
26  3  TYR A 37  ? ? -92.56  -93.84  
27  3  PRO A 50  ? ? -63.88  0.81    
28  3  ASN A 93  ? ? -158.11 74.82   
29  3  PRO A 100 ? ? -53.50  97.66   
30  4  PHE A 3   ? ? -110.14 -103.36 
31  4  SER A 36  ? ? 71.36   -46.27  
32  4  PRO A 83  ? ? -79.38  -75.50  
33  4  ASN A 93  ? ? -151.87 38.47   
34  4  PRO A 100 ? ? -53.55  107.38  
35  4  HIS A 101 ? ? -68.20  95.67   
36  5  ASN A 8   ? ? 74.81   100.68  
37  5  SER A 12  ? ? 54.94   -95.47  
38  5  TYR A 32  ? ? -47.49  90.60   
39  5  ASP A 33  ? ? 53.24   17.64   
40  5  TYR A 37  ? ? -81.76  -117.78 
41  5  ALA A 38  ? ? -172.68 147.36  
42  5  ASN A 93  ? ? -173.74 34.64   
43  5  PRO A 100 ? ? -31.61  119.64  
44  6  GLU A 2   ? ? 62.62   94.14   
45  6  LYS A 7   ? ? -97.93  57.86   
46  6  LYS A 30  ? ? -148.89 33.30   
47  6  TYR A 32  ? ? 71.10   -72.24  
48  6  ASP A 33  ? ? -149.84 24.94   
49  6  SER A 36  ? ? -109.46 -73.27  
50  6  TYR A 37  ? ? 37.23   -107.57 
51  6  ALA A 38  ? ? -154.56 -119.32 
52  6  PHE A 91  ? ? -83.69  41.83   
53  6  ASN A 93  ? ? -158.98 59.89   
54  6  PRO A 100 ? ? -45.45  107.03  
55  7  GLU A 2   ? ? -127.19 -83.27  
56  7  ASN A 5   ? ? 71.97   -47.33  
57  7  LYS A 7   ? ? 71.46   -63.05  
58  7  ASN A 8   ? ? -154.67 -52.11  
59  7  ASN A 9   ? ? 67.15   -67.95  
60  7  ASP A 15  ? ? -167.22 -49.08  
61  7  TYR A 32  ? ? -74.43  -77.08  
62  7  TYR A 37  ? ? -83.15  43.48   
63  7  ALA A 38  ? ? -67.80  67.38   
64  7  PRO A 82  ? ? -34.64  99.68   
65  7  ASN A 93  ? ? -160.09 72.53   
66  7  PRO A 100 ? ? -46.03  100.07  
67  8  ASN A 9   ? ? -83.56  -101.19 
68  8  ALA A 11  ? ? -167.96 -98.07  
69  8  SER A 36  ? ? 74.58   -47.39  
70  8  GLU A 60  ? ? -98.36  -70.56  
71  8  ASN A 93  ? ? -161.58 77.84   
72  8  PRO A 100 ? ? -57.95  104.28  
73  9  ASN A 5   ? ? -151.66 -128.33 
74  9  THR A 6   ? ? 53.91   -97.42  
75  9  LYS A 7   ? ? 74.09   -58.60  
76  9  ASP A 15  ? ? 72.68   -47.93  
77  9  TYR A 32  ? ? -115.40 -75.94  
78  9  SER A 36  ? ? -97.61  45.61   
79  9  CYS A 42  ? ? -152.89 57.64   
80  9  ASN A 93  ? ? -162.19 50.92   
81  10 PHE A 3   ? ? 69.25   -57.95  
82  10 ALA A 14  ? ? 76.39   -32.39  
83  10 TYR A 32  ? ? -68.29  -90.77  
84  10 SER A 36  ? ? -68.09  95.58   
85  10 TYR A 37  ? ? -123.26 -68.51  
86  10 ALA A 38  ? ? -174.80 -160.15 
87  10 CYS A 42  ? ? -163.56 90.33   
88  10 ASN A 93  ? ? -163.62 78.22   
89  10 PRO A 100 ? ? -53.23  109.45  
90  11 PHE A 3   ? ? 74.60   -47.14  
91  11 ASN A 9   ? ? -142.90 17.43   
92  11 LYS A 30  ? ? -151.40 33.48   
93  11 TYR A 32  ? ? 67.77   -70.10  
94  11 GLU A 60  ? ? -90.28  -65.77  
95  11 ASN A 93  ? ? -169.20 69.46   
96  12 ASN A 9   ? ? -146.36 -88.14  
97  12 ALA A 14  ? ? 62.42   -89.85  
98  12 PHE A 31  ? ? -104.97 69.70   
99  12 ASP A 33  ? ? 64.01   -1.25   
100 12 TYR A 37  ? ? -96.38  -144.17 
101 12 PRO A 50  ? ? -58.28  -6.94   
102 12 ASN A 93  ? ? -169.21 22.16   
103 12 PRO A 100 ? ? -40.07  106.62  
104 13 GLU A 2   ? ? 70.27   -57.91  
105 13 ASN A 5   ? ? -80.33  48.17   
106 13 LYS A 7   ? ? 56.95   -137.75 
107 13 ALA A 14  ? ? -129.67 -55.13  
108 13 TYR A 32  ? ? -85.60  -83.81  
109 13 ASN A 93  ? ? -153.08 46.78   
110 13 PRO A 100 ? ? -36.19  126.04  
111 14 GLU A 2   ? ? 70.51   -64.36  
112 14 ASN A 5   ? ? 54.22   76.16   
113 14 TYR A 32  ? ? -60.56  86.52   
114 14 ALA A 38  ? ? 68.62   152.52  
115 14 ASN A 93  ? ? -154.87 55.37   
116 14 PRO A 100 ? ? -36.06  114.50  
117 15 PHE A 3   ? ? -80.93  46.72   
118 15 THR A 6   ? ? -67.98  84.92   
119 15 LYS A 7   ? ? -164.39 -77.70  
120 15 ASP A 15  ? ? 65.22   -71.20  
121 15 LYS A 30  ? ? -150.81 32.14   
122 15 TYR A 32  ? ? 69.83   -66.38  
123 15 ASP A 33  ? ? -149.70 25.34   
124 15 TYR A 37  ? ? -110.64 -154.12 
125 15 ALA A 38  ? ? 73.33   118.59  
126 15 GLU A 60  ? ? -98.98  -76.58  
127 15 ASN A 93  ? ? -158.30 76.08   
128 15 PRO A 100 ? ? -33.23  118.72  
129 16 PHE A 3   ? ? 68.74   -75.79  
130 16 ASN A 5   ? ? -118.11 75.45   
131 16 THR A 6   ? ? 61.92   112.69  
132 16 ALA A 11  ? ? -171.92 -114.01 
133 16 TYR A 32  ? ? 66.77   75.84   
134 16 TYR A 37  ? ? -88.36  -157.27 
135 16 PRO A 82  ? ? -56.04  106.92  
136 16 ASN A 93  ? ? -170.07 75.15   
137 16 PRO A 100 ? ? -60.45  90.44   
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             TYR 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              32 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -10.70 
# 
_pdbx_nmr_ensemble.entry_id                                      1S62 
_pdbx_nmr_ensemble.conformers_calculated_total_number            1000 
_pdbx_nmr_ensemble.conformers_submitted_total_number             16 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1S62 
_pdbx_nmr_representative.conformer_id         3 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.4mM U-15N, 100mN NaCl, 50mM NaPO4, 90% H2O, 10% D2O'                                              '90% H2O/10% D2O' 
2 '0.5mM U-15N,13C, 50mN NaCl, 50mM NaPO4, Complete protease inhibitor (Boehringer), 90% H2O, 10% D2O' '90% H2O/10% D2O' 
3 '0.7mM U-15N, 500mN NaCl, 50mM NaPO4, 90% H2O, 10% D2O'                                              '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 300 ambient 6.8 '100mN NaCl, 50mM NaPO4' ? K 
2 300 ambient 6.8 '50mN NaCl, 50mM NaPO4'  ? K 
3 300 ambient 6.8 '500mN NaCl, 50mM NaPO4' ? K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D NOESY'             
2 2 2 3D_13C-separated_NOESY 
3 3 3 3D_15N-separated_NOESY 
# 
_pdbx_nmr_details.entry_id   1S62 
_pdbx_nmr_details.text       'NOE mixing time of 0.08 s, triple-resonance probe including shielded z-gradients' 
# 
_pdbx_nmr_refine.entry_id           1S62 
_pdbx_nmr_refine.method             
;2 step simulated annealing 
torsion angle dynamics
;
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
VNMR  ?    collection           varian     1 
Felix 2000 processing           Accelrys   2 
Felix 2000 'data analysis'      Accelrys   3 
ARIA  1.0  'structure solution' Nilges     4 
TALOS ?    'structure solution' Cornilescu 5 
TALOS ?    refinement           Cornilescu 6 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1  Y 1 A HIS 103 ? A HIS 103 
2  1  Y 1 A HIS 104 ? A HIS 104 
3  1  Y 1 A HIS 105 ? A HIS 105 
4  1  Y 1 A HIS 106 ? A HIS 106 
5  2  Y 1 A HIS 103 ? A HIS 103 
6  2  Y 1 A HIS 104 ? A HIS 104 
7  2  Y 1 A HIS 105 ? A HIS 105 
8  2  Y 1 A HIS 106 ? A HIS 106 
9  3  Y 1 A HIS 103 ? A HIS 103 
10 3  Y 1 A HIS 104 ? A HIS 104 
11 3  Y 1 A HIS 105 ? A HIS 105 
12 3  Y 1 A HIS 106 ? A HIS 106 
13 4  Y 1 A HIS 103 ? A HIS 103 
14 4  Y 1 A HIS 104 ? A HIS 104 
15 4  Y 1 A HIS 105 ? A HIS 105 
16 4  Y 1 A HIS 106 ? A HIS 106 
17 5  Y 1 A HIS 103 ? A HIS 103 
18 5  Y 1 A HIS 104 ? A HIS 104 
19 5  Y 1 A HIS 105 ? A HIS 105 
20 5  Y 1 A HIS 106 ? A HIS 106 
21 6  Y 1 A HIS 103 ? A HIS 103 
22 6  Y 1 A HIS 104 ? A HIS 104 
23 6  Y 1 A HIS 105 ? A HIS 105 
24 6  Y 1 A HIS 106 ? A HIS 106 
25 7  Y 1 A HIS 103 ? A HIS 103 
26 7  Y 1 A HIS 104 ? A HIS 104 
27 7  Y 1 A HIS 105 ? A HIS 105 
28 7  Y 1 A HIS 106 ? A HIS 106 
29 8  Y 1 A HIS 103 ? A HIS 103 
30 8  Y 1 A HIS 104 ? A HIS 104 
31 8  Y 1 A HIS 105 ? A HIS 105 
32 8  Y 1 A HIS 106 ? A HIS 106 
33 9  Y 1 A HIS 103 ? A HIS 103 
34 9  Y 1 A HIS 104 ? A HIS 104 
35 9  Y 1 A HIS 105 ? A HIS 105 
36 9  Y 1 A HIS 106 ? A HIS 106 
37 10 Y 1 A HIS 103 ? A HIS 103 
38 10 Y 1 A HIS 104 ? A HIS 104 
39 10 Y 1 A HIS 105 ? A HIS 105 
40 10 Y 1 A HIS 106 ? A HIS 106 
41 11 Y 1 A HIS 103 ? A HIS 103 
42 11 Y 1 A HIS 104 ? A HIS 104 
43 11 Y 1 A HIS 105 ? A HIS 105 
44 11 Y 1 A HIS 106 ? A HIS 106 
45 12 Y 1 A HIS 103 ? A HIS 103 
46 12 Y 1 A HIS 104 ? A HIS 104 
47 12 Y 1 A HIS 105 ? A HIS 105 
48 12 Y 1 A HIS 106 ? A HIS 106 
49 13 Y 1 A HIS 103 ? A HIS 103 
50 13 Y 1 A HIS 104 ? A HIS 104 
51 13 Y 1 A HIS 105 ? A HIS 105 
52 13 Y 1 A HIS 106 ? A HIS 106 
53 14 Y 1 A HIS 103 ? A HIS 103 
54 14 Y 1 A HIS 104 ? A HIS 104 
55 14 Y 1 A HIS 105 ? A HIS 105 
56 14 Y 1 A HIS 106 ? A HIS 106 
57 15 Y 1 A HIS 103 ? A HIS 103 
58 15 Y 1 A HIS 104 ? A HIS 104 
59 15 Y 1 A HIS 105 ? A HIS 105 
60 15 Y 1 A HIS 106 ? A HIS 106 
61 16 Y 1 A HIS 103 ? A HIS 103 
62 16 Y 1 A HIS 104 ? A HIS 104 
63 16 Y 1 A HIS 105 ? A HIS 105 
64 16 Y 1 A HIS 106 ? A HIS 106 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
SER N    N N N 287 
SER CA   C N S 288 
SER C    C N N 289 
SER O    O N N 290 
SER CB   C N N 291 
SER OG   O N N 292 
SER OXT  O N N 293 
SER H    H N N 294 
SER H2   H N N 295 
SER HA   H N N 296 
SER HB2  H N N 297 
SER HB3  H N N 298 
SER HG   H N N 299 
SER HXT  H N N 300 
THR N    N N N 301 
THR CA   C N S 302 
THR C    C N N 303 
THR O    O N N 304 
THR CB   C N R 305 
THR OG1  O N N 306 
THR CG2  C N N 307 
THR OXT  O N N 308 
THR H    H N N 309 
THR H2   H N N 310 
THR HA   H N N 311 
THR HB   H N N 312 
THR HG1  H N N 313 
THR HG21 H N N 314 
THR HG22 H N N 315 
THR HG23 H N N 316 
THR HXT  H N N 317 
TYR N    N N N 318 
TYR CA   C N S 319 
TYR C    C N N 320 
TYR O    O N N 321 
TYR CB   C N N 322 
TYR CG   C Y N 323 
TYR CD1  C Y N 324 
TYR CD2  C Y N 325 
TYR CE1  C Y N 326 
TYR CE2  C Y N 327 
TYR CZ   C Y N 328 
TYR OH   O N N 329 
TYR OXT  O N N 330 
TYR H    H N N 331 
TYR H2   H N N 332 
TYR HA   H N N 333 
TYR HB2  H N N 334 
TYR HB3  H N N 335 
TYR HD1  H N N 336 
TYR HD2  H N N 337 
TYR HE1  H N N 338 
TYR HE2  H N N 339 
TYR HH   H N N 340 
TYR HXT  H N N 341 
VAL N    N N N 342 
VAL CA   C N S 343 
VAL C    C N N 344 
VAL O    O N N 345 
VAL CB   C N N 346 
VAL CG1  C N N 347 
VAL CG2  C N N 348 
VAL OXT  O N N 349 
VAL H    H N N 350 
VAL H2   H N N 351 
VAL HA   H N N 352 
VAL HB   H N N 353 
VAL HG11 H N N 354 
VAL HG12 H N N 355 
VAL HG13 H N N 356 
VAL HG21 H N N 357 
VAL HG22 H N N 358 
VAL HG23 H N N 359 
VAL HXT  H N N 360 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TYR N   CA   sing N N 304 
TYR N   H    sing N N 305 
TYR N   H2   sing N N 306 
TYR CA  C    sing N N 307 
TYR CA  CB   sing N N 308 
TYR CA  HA   sing N N 309 
TYR C   O    doub N N 310 
TYR C   OXT  sing N N 311 
TYR CB  CG   sing N N 312 
TYR CB  HB2  sing N N 313 
TYR CB  HB3  sing N N 314 
TYR CG  CD1  doub Y N 315 
TYR CG  CD2  sing Y N 316 
TYR CD1 CE1  sing Y N 317 
TYR CD1 HD1  sing N N 318 
TYR CD2 CE2  doub Y N 319 
TYR CD2 HD2  sing N N 320 
TYR CE1 CZ   doub Y N 321 
TYR CE1 HE1  sing N N 322 
TYR CE2 CZ   sing Y N 323 
TYR CE2 HE2  sing N N 324 
TYR CZ  OH   sing N N 325 
TYR OH  HH   sing N N 326 
TYR OXT HXT  sing N N 327 
VAL N   CA   sing N N 328 
VAL N   H    sing N N 329 
VAL N   H2   sing N N 330 
VAL CA  C    sing N N 331 
VAL CA  CB   sing N N 332 
VAL CA  HA   sing N N 333 
VAL C   O    doub N N 334 
VAL C   OXT  sing N N 335 
VAL CB  CG1  sing N N 336 
VAL CB  CG2  sing N N 337 
VAL CB  HB   sing N N 338 
VAL CG1 HG11 sing N N 339 
VAL CG1 HG12 sing N N 340 
VAL CG1 HG13 sing N N 341 
VAL CG2 HG21 sing N N 342 
VAL CG2 HG22 sing N N 343 
VAL CG2 HG23 sing N N 344 
VAL OXT HXT  sing N N 345 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_atom_sites.entry_id                    1S62 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_