data_1S6U # _entry.id 1S6U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1S6U pdb_00001s6u 10.2210/pdb1s6u/pdb RCSB RCSB021440 ? ? WWPDB D_1000021440 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-06 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 4 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 5 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 9 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 4 'Structure model' '_struct_ref_seq_dif.details' 16 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1S6U _pdbx_database_status.recvd_initial_deposition_date 2004-01-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1s6o 'Structure of the same protein in its apo- form' unspecified TargetDB CIRMMP25 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Banci, L.' 1 'Bertini, I.' 2 'Del Conte, R.' 3 ;D'Onofrio, M. ; 4 'Rosato, A.' 5 'Structural Proteomics in Europe (SPINE)' 6 # _citation.id primary _citation.title 'Solution Structure and Backbone Dynamics of the Cu(I) and Apo Forms of the Second Metal-Binding Domain of the Menkes Protein ATP7A.' _citation.journal_abbrev Biochemistry _citation.journal_volume 43 _citation.page_first 3396 _citation.page_last 3403 _citation.year 2004 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15035611 _citation.pdbx_database_id_DOI 10.1021/bi036042s # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Banci, L.' 1 ? primary 'Bertini, I.' 2 ? primary 'Del Conte, R.' 3 ? primary ;D'Onofrio, M. ; 4 ? primary 'Rosato, A.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Copper-transporting ATPase 1' 8459.984 1 3.6.3.4 ? 'Second domain of ATP7A' ? 2 non-polymer syn 'COPPER (I) ION' 63.546 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Copper pump 1, Menkes disease-associated protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKKIEGR _entity_poly.pdbx_seq_one_letter_code_can GEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKKIEGR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CIRMMP25 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'COPPER (I) ION' _pdbx_entity_nonpoly.comp_id CU1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 VAL n 1 4 VAL n 1 5 LEU n 1 6 LYS n 1 7 MET n 1 8 LYS n 1 9 VAL n 1 10 GLU n 1 11 GLY n 1 12 MET n 1 13 THR n 1 14 CYS n 1 15 HIS n 1 16 SER n 1 17 CYS n 1 18 THR n 1 19 SER n 1 20 THR n 1 21 ILE n 1 22 GLU n 1 23 GLY n 1 24 LYS n 1 25 ILE n 1 26 GLY n 1 27 LYS n 1 28 LEU n 1 29 GLN n 1 30 GLY n 1 31 VAL n 1 32 GLN n 1 33 ARG n 1 34 ILE n 1 35 LYS n 1 36 VAL n 1 37 SER n 1 38 LEU n 1 39 ASP n 1 40 ASN n 1 41 GLN n 1 42 GLU n 1 43 ALA n 1 44 THR n 1 45 ILE n 1 46 VAL n 1 47 TYR n 1 48 GLN n 1 49 PRO n 1 50 HIS n 1 51 LEU n 1 52 ILE n 1 53 SER n 1 54 VAL n 1 55 GLU n 1 56 GLU n 1 57 MET n 1 58 LYS n 1 59 LYS n 1 60 GLN n 1 61 ILE n 1 62 GLU n 1 63 ALA n 1 64 MET n 1 65 GLY n 1 66 PHE n 1 67 PRO n 1 68 ALA n 1 69 PHE n 1 70 VAL n 1 71 LYS n 1 72 LYS n 1 73 ILE n 1 74 GLU n 1 75 GLY n 1 76 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'ATP7A, MNK, MC1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet20b+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU1 non-polymer . 'COPPER (I) ION' ? 'Cu 1' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ARG 76 76 76 ARG ARG A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CU1 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 77 _pdbx_nonpoly_scheme.auth_seq_num 77 _pdbx_nonpoly_scheme.pdb_mon_id CU1 _pdbx_nonpoly_scheme.auth_mon_id CU _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 1S6U _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1S6U _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1S6U _struct.title 'Solution structure and backbone dynamics of the Cu(I) form of the second metal-binding domain of the Menkes protein ATP7A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1S6U _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'copper homeostasis, metal transport, Menkes, Structural Proteomics in Europe, SPINE, Structural Genomics, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATP7A_HUMAN _struct_ref.pdbx_db_accession Q04656 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKK _struct_ref.pdbx_align_begin 169 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1S6U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q04656 _struct_ref_seq.db_align_beg 169 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1S6U ILE A 73 ? UNP Q04656 ? ? 'cloning artifact' 73 1 1 1S6U GLU A 74 ? UNP Q04656 ? ? 'cloning artifact' 74 2 1 1S6U GLY A 75 ? UNP Q04656 ? ? 'cloning artifact' 75 3 1 1S6U ARG A 76 ? UNP Q04656 ? ? 'cloning artifact' 76 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 14 ? LEU A 28 ? CYS A 14 LEU A 28 1 ? 15 HELX_P HELX_P2 2 SER A 53 ? GLY A 65 ? SER A 53 GLY A 65 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 14 A CU1 77 1_555 ? ? ? ? ? ? ? 2.159 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 17 A CU1 77 1_555 ? ? ? ? ? ? ? 2.173 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id SG _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id CYS _pdbx_struct_conn_angle.ptnr1_label_seq_id 14 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id CYS _pdbx_struct_conn_angle.ptnr1_auth_seq_id 14 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id CU _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id CU1 _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id CU1 _pdbx_struct_conn_angle.ptnr2_auth_seq_id 77 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id SG _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id CYS _pdbx_struct_conn_angle.ptnr3_label_seq_id 17 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id CYS _pdbx_struct_conn_angle.ptnr3_auth_seq_id 17 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 114.2 _pdbx_struct_conn_angle.value_esd ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 31 ? VAL A 36 ? VAL A 31 VAL A 36 A 2 GLU A 42 ? TYR A 47 ? GLU A 42 TYR A 47 A 3 VAL A 3 ? VAL A 9 ? VAL A 3 VAL A 9 A 4 ALA A 68 ? VAL A 70 ? ALA A 68 VAL A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 35 ? N LYS A 35 O THR A 44 ? O THR A 44 A 2 3 O ALA A 43 ? O ALA A 43 N MET A 7 ? N MET A 7 A 3 4 N LYS A 8 ? N LYS A 8 O PHE A 69 ? O PHE A 69 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CU1 _struct_site.pdbx_auth_seq_id 77 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE CU1 A 77' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 CYS A 14 ? CYS A 14 . ? 1_555 ? 2 AC1 2 CYS A 17 ? CYS A 17 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 CD A ARG 76 ? ? NE A ARG 76 ? ? CZ A ARG 76 ? ? 132.01 123.60 8.41 1.40 N 2 4 NE A ARG 76 ? ? CZ A ARG 76 ? ? NH2 A ARG 76 ? ? 116.33 120.30 -3.97 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 12 ? ? -65.82 85.72 2 1 LEU A 38 ? ? -133.58 -48.15 3 1 GLN A 41 ? ? 32.33 63.87 4 1 HIS A 50 ? ? -179.25 -52.95 5 1 PHE A 69 ? ? -107.81 78.74 6 1 LYS A 71 ? ? -156.77 56.80 7 1 GLU A 74 ? ? -96.79 59.50 8 2 MET A 12 ? ? -61.99 92.05 9 2 THR A 13 ? ? -144.46 48.67 10 2 HIS A 15 ? ? -77.26 44.27 11 2 SER A 16 ? ? -129.54 -59.76 12 2 LEU A 38 ? ? -141.09 -48.85 13 2 GLN A 41 ? ? 37.29 62.27 14 2 LEU A 51 ? ? -107.97 -64.71 15 2 PHE A 69 ? ? -114.49 78.30 16 2 LYS A 71 ? ? -155.41 57.09 17 2 ILE A 73 ? ? -153.04 65.19 18 3 GLU A 2 ? ? -48.85 160.04 19 3 GLN A 41 ? ? 33.61 62.93 20 3 HIS A 50 ? ? 177.13 -41.04 21 3 PHE A 69 ? ? -104.78 76.89 22 3 VAL A 70 ? ? -52.58 108.00 23 3 LYS A 71 ? ? -155.38 59.79 24 3 ILE A 73 ? ? -152.36 65.05 25 4 MET A 12 ? ? -64.59 86.39 26 4 SER A 16 ? ? 73.74 -65.73 27 4 GLN A 29 ? ? -68.68 91.71 28 4 LEU A 38 ? ? -131.56 -46.08 29 4 GLN A 41 ? ? 35.98 58.41 30 4 HIS A 50 ? ? -179.09 -43.25 31 4 PHE A 69 ? ? -108.21 78.07 32 4 VAL A 70 ? ? -56.08 109.36 33 4 LYS A 71 ? ? -155.82 55.55 34 5 MET A 12 ? ? -65.92 94.72 35 5 THR A 13 ? ? -119.72 53.92 36 5 LEU A 38 ? ? -120.82 -56.98 37 5 GLN A 41 ? ? 32.15 68.33 38 5 HIS A 50 ? ? -173.43 -46.26 39 5 PHE A 69 ? ? -107.28 74.90 40 5 LYS A 71 ? ? -154.57 55.65 41 6 SER A 16 ? ? 80.05 -64.73 42 6 GLN A 41 ? ? 34.19 57.65 43 6 HIS A 50 ? ? -177.23 -43.79 44 6 PHE A 69 ? ? -108.09 78.73 45 6 LYS A 71 ? ? -156.18 58.48 46 7 MET A 12 ? ? -67.30 78.64 47 7 SER A 16 ? ? -136.77 -64.54 48 7 GLN A 29 ? ? -69.51 80.17 49 7 HIS A 50 ? ? -177.33 -43.93 50 7 LYS A 71 ? ? -155.31 58.98 51 8 GLU A 2 ? ? 78.69 108.85 52 8 HIS A 15 ? ? 84.45 -31.17 53 8 GLN A 41 ? ? 30.81 67.35 54 8 HIS A 50 ? ? -173.23 -38.34 55 8 PHE A 69 ? ? -111.70 76.83 56 8 LYS A 71 ? ? -156.09 57.00 57 9 THR A 13 ? ? -148.33 39.35 58 9 GLN A 41 ? ? 32.20 62.70 59 9 HIS A 50 ? ? 175.21 -42.71 60 9 PHE A 69 ? ? -113.22 78.56 61 9 LYS A 71 ? ? -155.47 59.70 62 9 ILE A 73 ? ? -151.56 55.88 63 10 MET A 12 ? ? 45.40 -140.33 64 10 HIS A 50 ? ? 87.27 -23.02 65 10 PHE A 69 ? ? -117.38 79.07 66 10 LYS A 71 ? ? -154.29 59.81 67 10 ILE A 73 ? ? -155.46 55.58 68 11 MET A 12 ? ? -68.93 85.38 69 11 LEU A 38 ? ? -147.52 -47.80 70 11 GLN A 41 ? ? 36.52 61.48 71 11 HIS A 50 ? ? -174.73 -42.15 72 11 PHE A 69 ? ? -100.60 72.14 73 11 VAL A 70 ? ? -57.55 94.91 74 11 LYS A 71 ? ? -158.51 84.32 75 12 MET A 12 ? ? -69.19 95.33 76 12 GLN A 41 ? ? 41.23 70.99 77 12 HIS A 50 ? ? 176.54 -44.22 78 12 PHE A 69 ? ? -103.81 77.51 79 12 LYS A 71 ? ? -155.58 55.46 80 12 ILE A 73 ? ? -147.69 56.88 81 13 MET A 12 ? ? -62.79 86.43 82 13 THR A 13 ? ? -148.19 47.75 83 13 HIS A 15 ? ? 66.08 -25.69 84 13 SER A 16 ? ? -67.50 -75.15 85 13 GLN A 29 ? ? -69.66 90.07 86 13 GLN A 41 ? ? 38.50 58.67 87 13 HIS A 50 ? ? -176.01 -47.00 88 13 PHE A 69 ? ? -112.89 73.93 89 13 LYS A 71 ? ? -157.29 54.62 90 13 LYS A 72 ? ? -159.05 80.71 91 14 MET A 12 ? ? -69.09 75.69 92 14 THR A 13 ? ? -142.26 58.20 93 14 CYS A 14 ? ? -150.85 16.83 94 14 HIS A 15 ? ? 68.80 -35.39 95 14 HIS A 50 ? ? -178.74 -43.21 96 14 VAL A 70 ? ? -58.45 107.87 97 14 LYS A 71 ? ? -159.02 56.87 98 15 GLU A 2 ? ? -53.64 174.83 99 15 GLN A 41 ? ? 36.22 67.34 100 15 HIS A 50 ? ? -176.08 -44.86 101 15 PHE A 69 ? ? -112.19 76.21 102 15 LYS A 71 ? ? -154.58 53.66 103 15 ILE A 73 ? ? -153.82 60.36 104 16 MET A 12 ? ? -58.97 93.36 105 16 THR A 13 ? ? -141.84 47.45 106 16 LEU A 38 ? ? -139.05 -47.25 107 16 HIS A 50 ? ? -178.17 -41.27 108 16 LYS A 71 ? ? -156.80 54.74 109 16 LYS A 72 ? ? -158.34 67.44 110 17 GLU A 2 ? ? 40.48 78.69 111 17 THR A 13 ? ? -153.12 26.36 112 17 HIS A 15 ? ? 72.71 -46.99 113 17 GLN A 41 ? ? 28.15 70.72 114 17 HIS A 50 ? ? -173.58 -46.51 115 17 PHE A 69 ? ? -100.41 75.04 116 17 LYS A 71 ? ? -157.13 58.51 117 18 GLU A 2 ? ? 56.45 -147.76 118 18 MET A 12 ? ? -68.00 94.14 119 18 GLN A 41 ? ? 31.40 58.71 120 18 HIS A 50 ? ? -173.98 -46.01 121 18 LYS A 71 ? ? -157.73 54.16 122 19 MET A 12 ? ? -64.33 91.49 123 19 SER A 16 ? ? -136.89 -64.07 124 19 LEU A 38 ? ? -142.44 -47.37 125 19 HIS A 50 ? ? -169.66 -47.07 126 19 PHE A 69 ? ? -107.05 71.39 127 19 VAL A 70 ? ? -59.45 105.40 128 19 LYS A 71 ? ? -155.58 55.31 129 20 SER A 16 ? ? -145.88 -63.38 130 20 THR A 18 ? ? -53.04 -70.16 131 20 HIS A 50 ? ? 73.62 -42.39 132 20 PHE A 69 ? ? -108.43 75.50 133 20 LYS A 71 ? ? -155.74 56.71 134 21 MET A 12 ? ? -65.14 82.74 135 21 SER A 37 ? ? -110.69 79.80 136 21 GLN A 41 ? ? 35.66 53.82 137 21 HIS A 50 ? ? -169.86 -40.21 138 21 VAL A 70 ? ? -42.69 104.18 139 22 MET A 12 ? ? -55.26 96.25 140 22 SER A 16 ? ? -142.45 -59.96 141 22 LEU A 38 ? ? -155.33 -48.79 142 22 GLN A 41 ? ? 39.65 61.82 143 22 HIS A 50 ? ? -179.54 -42.46 144 22 VAL A 70 ? ? -36.03 106.95 145 23 GLU A 2 ? ? -53.45 171.98 146 23 MET A 12 ? ? -66.53 94.65 147 23 SER A 16 ? ? -81.10 -74.75 148 23 GLN A 41 ? ? 38.86 61.56 149 23 HIS A 50 ? ? -174.14 -46.78 150 23 LYS A 71 ? ? -157.09 59.70 151 24 MET A 12 ? ? -55.06 96.95 152 24 GLN A 41 ? ? 36.44 62.28 153 24 HIS A 50 ? ? -177.53 -48.92 154 24 LYS A 71 ? ? -157.66 60.99 155 25 GLU A 2 ? ? -65.02 -176.30 156 25 MET A 12 ? ? -67.31 80.84 157 25 THR A 13 ? ? -118.67 65.01 158 25 GLN A 29 ? ? -66.42 87.87 159 25 GLN A 41 ? ? 35.83 49.44 160 25 HIS A 50 ? ? -174.22 -49.79 161 25 PHE A 69 ? ? -108.15 72.60 162 25 LYS A 71 ? ? -156.10 56.52 163 25 ILE A 73 ? ? -155.67 70.73 164 26 THR A 13 ? ? -146.51 19.39 165 26 HIS A 15 ? ? -81.14 42.38 166 26 SER A 16 ? ? -122.42 -69.11 167 26 GLN A 41 ? ? 35.19 60.21 168 26 HIS A 50 ? ? 178.97 -38.88 169 26 PHE A 69 ? ? -105.51 76.02 170 26 LYS A 71 ? ? -156.98 53.80 171 26 LYS A 72 ? ? -159.04 81.47 172 27 MET A 12 ? ? -66.36 99.14 173 27 THR A 13 ? ? -143.78 56.52 174 27 HIS A 15 ? ? -80.58 44.68 175 27 SER A 16 ? ? -123.17 -60.33 176 27 GLN A 29 ? ? -68.67 91.17 177 27 GLN A 41 ? ? 24.89 74.84 178 27 HIS A 50 ? ? -175.32 -50.03 179 27 PHE A 69 ? ? -105.70 76.23 180 27 LYS A 71 ? ? -155.73 60.01 181 27 ILE A 73 ? ? -156.88 70.39 182 28 MET A 12 ? ? -61.01 86.78 183 28 GLN A 41 ? ? 32.85 66.77 184 28 HIS A 50 ? ? -177.91 -39.40 185 28 VAL A 70 ? ? -42.02 107.85 186 29 GLU A 2 ? ? -47.15 152.84 187 29 GLN A 41 ? ? 28.90 60.90 188 29 HIS A 50 ? ? -177.09 -41.21 189 29 PHE A 69 ? ? -106.47 71.74 190 29 LYS A 71 ? ? -150.89 55.19 191 29 ILE A 73 ? ? -150.57 59.02 192 30 GLU A 2 ? ? -82.81 -154.75 193 30 THR A 13 ? ? -143.40 -56.99 194 30 GLN A 41 ? ? 32.37 62.69 195 30 HIS A 50 ? ? -168.22 -53.21 196 30 PHE A 69 ? ? -114.66 79.03 197 30 LYS A 71 ? ? -152.98 54.72 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 22 GLY A 75 ? ? ARG A 76 ? ? 143.77 2 23 GLY A 1 ? ? GLU A 2 ? ? 135.37 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 12 ARG A 76 ? ? 0.093 'SIDE CHAIN' 2 15 TYR A 47 ? ? 0.078 'SIDE CHAIN' 3 18 ARG A 76 ? ? 0.089 'SIDE CHAIN' 4 19 ARG A 76 ? ? 0.079 'SIDE CHAIN' 5 20 TYR A 47 ? ? 0.093 'SIDE CHAIN' 6 21 TYR A 47 ? ? 0.100 'SIDE CHAIN' 7 22 TYR A 47 ? ? 0.093 'SIDE CHAIN' # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Proteomics in Europe' _pdbx_SG_project.initial_of_center SPINE # _pdbx_nmr_ensemble.entry_id 1S6U _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM protein, 1:1 copper(I)' '90% H2O/10% D2O' 2 '1 mM protein U-15N, 1:1 copper(I)' '90% H2O/10% D2O' 3 '1 mM protein U-15N,13C, 1:1 copper(I)' '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '[1H-1H]-NOESY' 2 3 1 13C-NOESY-HSQC 3 2 1 15N-NOESY-HSQC 4 2 1 HNHA # _pdbx_nmr_refine.entry_id 1S6U _pdbx_nmr_refine.method 'restrained energy minimization' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' Guentert 1 DYANA 1.5 refinement Guentert 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU1 CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TYR N N N N 319 TYR CA C N S 320 TYR C C N N 321 TYR O O N N 322 TYR CB C N N 323 TYR CG C Y N 324 TYR CD1 C Y N 325 TYR CD2 C Y N 326 TYR CE1 C Y N 327 TYR CE2 C Y N 328 TYR CZ C Y N 329 TYR OH O N N 330 TYR OXT O N N 331 TYR H H N N 332 TYR H2 H N N 333 TYR HA H N N 334 TYR HB2 H N N 335 TYR HB3 H N N 336 TYR HD1 H N N 337 TYR HD2 H N N 338 TYR HE1 H N N 339 TYR HE2 H N N 340 TYR HH H N N 341 TYR HXT H N N 342 VAL N N N N 343 VAL CA C N S 344 VAL C C N N 345 VAL O O N N 346 VAL CB C N N 347 VAL CG1 C N N 348 VAL CG2 C N N 349 VAL OXT O N N 350 VAL H H N N 351 VAL H2 H N N 352 VAL HA H N N 353 VAL HB H N N 354 VAL HG11 H N N 355 VAL HG12 H N N 356 VAL HG13 H N N 357 VAL HG21 H N N 358 VAL HG22 H N N 359 VAL HG23 H N N 360 VAL HXT H N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _atom_sites.entry_id 1S6U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU H N O S # loop_