data_1S7A # _entry.id 1S7A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1S7A pdb_00001s7a 10.2210/pdb1s7a/pdb RCSB RCSB021456 ? ? WWPDB D_1000021456 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-06 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1S7A _pdbx_database_status.recvd_initial_deposition_date 2004-01-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 6044 'NMR assignment of the same domain' unspecified PDB 1S79 'Structure of the adjacent RRM' unspecified PDB 1OWX 'Structure of the C-terminal RRM of the La protein' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Alfano, C.' 1 'Sanfelice, D.' 2 'Babon, J.' 3 'Kelly, G.' 4 'Jacks, A.' 5 'Curry, S.' 6 'Conte, M.R.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structural analysis of cooperative RNA binding by the La motif and central RRM domain of human La protein.' Nat.Struct.Mol.Biol. 11 323 329 2004 ? US 1545-9993 ? ? 15004549 10.1038/nsmb747 1 'Resonance assignment and secondary structure of the La motif' J.Biomol.NMR 27 93 94 ? JBNME9 NE 0925-2738 0800 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Alfano, C.' 1 ? primary 'Sanfelice, D.' 2 ? primary 'Babon, J.' 3 ? primary 'Kelly, G.' 4 ? primary 'Jacks, A.' 5 ? primary 'Curry, S.' 6 ? primary 'Conte, M.R.' 7 ? 1 'Sanfelice, D.' 8 ? 1 'Babon, J.' 9 ? 1 'Kelly, G.' 10 ? 1 'Curry, S.' 11 ? 1 'Conte, M.R.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Lupus La protein' _entity.formula_weight 12020.791 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'La motif' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Sjogren syndrome type B antigen, SS-B, La ribonucleoprotein, La autoantigen' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELM EISEDKTKIRRSPSKPLPEVTDE ; _entity_poly.pdbx_seq_one_letter_code_can ;MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELM EISEDKTKIRRSPSKPLPEVTDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 ASN n 1 5 GLY n 1 6 ASP n 1 7 ASN n 1 8 GLU n 1 9 LYS n 1 10 MET n 1 11 ALA n 1 12 ALA n 1 13 LEU n 1 14 GLU n 1 15 ALA n 1 16 LYS n 1 17 ILE n 1 18 CYS n 1 19 HIS n 1 20 GLN n 1 21 ILE n 1 22 GLU n 1 23 TYR n 1 24 TYR n 1 25 PHE n 1 26 GLY n 1 27 ASP n 1 28 PHE n 1 29 ASN n 1 30 LEU n 1 31 PRO n 1 32 ARG n 1 33 ASP n 1 34 LYS n 1 35 PHE n 1 36 LEU n 1 37 LYS n 1 38 GLU n 1 39 GLN n 1 40 ILE n 1 41 LYS n 1 42 LEU n 1 43 ASP n 1 44 GLU n 1 45 GLY n 1 46 TRP n 1 47 VAL n 1 48 PRO n 1 49 LEU n 1 50 GLU n 1 51 ILE n 1 52 MET n 1 53 ILE n 1 54 LYS n 1 55 PHE n 1 56 ASN n 1 57 ARG n 1 58 LEU n 1 59 ASN n 1 60 ARG n 1 61 LEU n 1 62 THR n 1 63 THR n 1 64 ASP n 1 65 PHE n 1 66 ASN n 1 67 VAL n 1 68 ILE n 1 69 VAL n 1 70 GLU n 1 71 ALA n 1 72 LEU n 1 73 SER n 1 74 LYS n 1 75 SER n 1 76 LYS n 1 77 ALA n 1 78 GLU n 1 79 LEU n 1 80 MET n 1 81 GLU n 1 82 ILE n 1 83 SER n 1 84 GLU n 1 85 ASP n 1 86 LYS n 1 87 THR n 1 88 LYS n 1 89 ILE n 1 90 ARG n 1 91 ARG n 1 92 SER n 1 93 PRO n 1 94 SER n 1 95 LYS n 1 96 PRO n 1 97 LEU n 1 98 PRO n 1 99 GLU n 1 100 VAL n 1 101 THR n 1 102 ASP n 1 103 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SSB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)PlysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET30 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLU 103 103 103 GLU GLU A . n # _exptl.entry_id 1S7A _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1S7A _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1S7A _struct.title 'NMR structure of the La motif of human La protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1S7A _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN, TRANSLATION' _struct_keywords.text 'La motif, alpha/beta, winged helix domain, RNA BINDING PROTEIN, TRANSLATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LA_HUMAN _struct_ref.pdbx_db_accession P05455 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELM EISEDKTKIRRSPSKPLPEVTDE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1S7A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05455 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 103 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 7 ? GLY A 26 ? ASN A 7 GLY A 26 1 ? 20 HELX_P HELX_P2 2 ASN A 29 ? ARG A 32 ? ASN A 29 ARG A 32 5 ? 4 HELX_P HELX_P3 3 ASP A 33 ? ASP A 43 ? ASP A 33 ASP A 43 1 ? 11 HELX_P HELX_P4 4 LEU A 49 ? PHE A 55 ? LEU A 49 PHE A 55 1 ? 7 HELX_P HELX_P5 5 PHE A 55 ? ARG A 60 ? PHE A 55 ARG A 60 1 ? 6 HELX_P HELX_P6 6 ASP A 64 ? SER A 75 ? ASP A 64 SER A 75 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 47 ? PRO A 48 ? VAL A 47 PRO A 48 A 2 LYS A 88 ? ARG A 90 ? LYS A 88 ARG A 90 A 3 GLU A 81 ? ILE A 82 ? GLU A 81 ILE A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 47 ? N VAL A 47 O ILE A 89 ? O ILE A 89 A 2 3 O ARG A 90 ? O ARG A 90 N GLU A 81 ? N GLU A 81 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 25 ? ? H A ASP 27 ? ? 1.22 2 1 O A GLU 22 ? ? H A GLY 26 ? ? 1.46 3 1 O A LEU 49 ? ? H A ILE 53 ? ? 1.50 4 1 O A ASP 64 ? ? H A ILE 68 ? ? 1.50 5 1 O A VAL 47 ? ? H A ILE 89 ? ? 1.58 6 1 H A VAL 47 ? ? O A ILE 89 ? ? 1.60 7 1 O A VAL 69 ? ? H A SER 73 ? ? 1.60 8 1 O A PHE 25 ? ? N A ASP 27 ? ? 2.15 9 1 O A GLU 22 ? ? N A GLY 26 ? ? 2.18 10 2 O A PHE 25 ? ? H A ASP 27 ? ? 1.22 11 2 O A GLU 22 ? ? H A GLY 26 ? ? 1.50 12 2 O A LEU 49 ? ? H A ILE 53 ? ? 1.56 13 2 O A VAL 47 ? ? H A ILE 89 ? ? 1.58 14 2 H A VAL 47 ? ? O A ILE 89 ? ? 1.59 15 2 O A PHE 25 ? ? N A ASP 27 ? ? 2.14 16 3 O A LEU 49 ? ? H A ILE 53 ? ? 1.43 17 3 O A ASP 64 ? ? H A ILE 68 ? ? 1.47 18 3 O A GLU 22 ? ? H A GLY 26 ? ? 1.59 19 4 O A VAL 47 ? ? H A ILE 89 ? ? 1.60 20 5 O A GLU 22 ? ? H A GLY 26 ? ? 1.45 21 5 O A ASP 64 ? ? H A ILE 68 ? ? 1.55 22 5 O A LEU 49 ? ? H A ILE 53 ? ? 1.56 23 5 O A VAL 47 ? ? H A ILE 89 ? ? 1.58 24 5 O A GLU 22 ? ? N A GLY 26 ? ? 2.15 25 6 O A PHE 25 ? ? H A ASP 27 ? ? 1.26 26 6 HD21 A ASN 29 ? ? OD1 A ASP 33 ? ? 1.45 27 6 O A GLU 22 ? ? H A GLY 26 ? ? 1.48 28 6 O A LEU 49 ? ? H A ILE 53 ? ? 1.50 29 6 O A VAL 47 ? ? H A ILE 89 ? ? 1.58 30 6 O A PHE 25 ? ? N A ASP 27 ? ? 2.18 31 6 O A GLU 22 ? ? N A GLY 26 ? ? 2.19 32 7 O A LEU 49 ? ? H A ILE 53 ? ? 1.51 33 7 O A VAL 47 ? ? H A ILE 89 ? ? 1.58 34 7 H A VAL 47 ? ? O A ILE 89 ? ? 1.58 35 8 O A PHE 25 ? ? H A ASP 27 ? ? 1.18 36 8 O A GLU 22 ? ? H A GLY 26 ? ? 1.48 37 8 O A LEU 49 ? ? H A ILE 53 ? ? 1.50 38 8 O A VAL 69 ? ? H A SER 73 ? ? 1.51 39 8 O A VAL 47 ? ? H A ILE 89 ? ? 1.58 40 8 O A PHE 25 ? ? N A ASP 27 ? ? 2.11 41 9 O A PHE 25 ? ? H A ASP 27 ? ? 1.18 42 9 O A LEU 49 ? ? H A ILE 53 ? ? 1.47 43 9 O A ASN 29 ? ? H A ASP 33 ? ? 1.54 44 9 O A VAL 47 ? ? H A ILE 89 ? ? 1.56 45 9 O A GLU 22 ? ? H A GLY 26 ? ? 1.56 46 9 O A PHE 25 ? ? N A ASP 27 ? ? 2.10 47 10 O A LEU 49 ? ? H A ILE 53 ? ? 1.43 48 10 O A ASN 29 ? ? H A ASP 33 ? ? 1.56 49 10 O A GLU 22 ? ? H A GLY 26 ? ? 1.57 50 11 O A ASP 64 ? ? H A ILE 68 ? ? 1.50 51 11 O A LEU 49 ? ? H A ILE 53 ? ? 1.53 52 11 O A VAL 47 ? ? H A ILE 89 ? ? 1.58 53 11 O A ASN 29 ? ? H A ASP 33 ? ? 1.59 54 12 O A GLU 22 ? ? H A GLY 26 ? ? 1.39 55 12 O A LEU 49 ? ? H A ILE 53 ? ? 1.51 56 12 O A ASN 29 ? ? H A ASP 33 ? ? 1.52 57 12 H A VAL 47 ? ? O A ILE 89 ? ? 1.58 58 12 O A PHE 55 ? ? H A ASN 59 ? ? 1.59 59 12 O A VAL 47 ? ? H A ILE 89 ? ? 1.59 60 12 O A GLU 22 ? ? N A GLY 26 ? ? 2.16 61 13 O A ASN 29 ? ? H A ASP 33 ? ? 1.52 62 13 O A LEU 49 ? ? H A ILE 53 ? ? 1.55 63 13 O A VAL 47 ? ? H A ILE 89 ? ? 1.58 64 13 H A GLU 81 ? ? O A ARG 90 ? ? 1.59 65 14 O A PHE 25 ? ? H A ASP 27 ? ? 1.15 66 14 O A GLU 22 ? ? H A GLY 26 ? ? 1.47 67 14 O A ASN 29 ? ? H A ASP 33 ? ? 1.51 68 14 O A ASP 64 ? ? H A ILE 68 ? ? 1.56 69 14 H A VAL 47 ? ? O A ILE 89 ? ? 1.59 70 14 O A PHE 25 ? ? N A ASP 27 ? ? 2.08 71 15 O A PHE 25 ? ? H A ASP 27 ? ? 1.22 72 15 O A GLU 22 ? ? H A GLY 26 ? ? 1.51 73 15 O A ASP 64 ? ? H A ILE 68 ? ? 1.57 74 15 O A LEU 49 ? ? H A ILE 53 ? ? 1.57 75 15 O A VAL 47 ? ? H A ILE 89 ? ? 1.58 76 15 O A PHE 25 ? ? N A ASP 27 ? ? 2.15 77 16 O A PHE 25 ? ? H A ASP 27 ? ? 1.14 78 16 O A ASN 29 ? ? H A ASP 33 ? ? 1.55 79 16 O A GLU 22 ? ? H A GLY 26 ? ? 1.55 80 16 H A VAL 47 ? ? O A ILE 89 ? ? 1.59 81 16 O A VAL 47 ? ? H A ILE 89 ? ? 1.60 82 16 O A PHE 25 ? ? N A ASP 27 ? ? 2.06 83 17 O A PHE 25 ? ? H A ASP 27 ? ? 1.12 84 17 O A GLU 22 ? ? H A GLY 26 ? ? 1.58 85 17 O A ASN 29 ? ? H A ASP 33 ? ? 1.59 86 17 O A LEU 49 ? ? H A ILE 53 ? ? 1.59 87 17 O A VAL 47 ? ? H A ILE 89 ? ? 1.59 88 17 O A PHE 25 ? ? N A ASP 27 ? ? 2.05 89 18 OD1 A ASP 43 ? ? H A GLY 45 ? ? 1.55 90 18 O A VAL 47 ? ? H A ILE 89 ? ? 1.57 91 19 O A PHE 25 ? ? H A ASP 27 ? ? 1.18 92 19 O A GLU 22 ? ? H A GLY 26 ? ? 1.57 93 19 O A VAL 47 ? ? H A ILE 89 ? ? 1.59 94 19 O A PHE 25 ? ? N A ASP 27 ? ? 2.10 95 20 O A PHE 25 ? ? H A ASP 27 ? ? 1.14 96 20 O A LEU 49 ? ? H A ILE 53 ? ? 1.46 97 20 O A ASN 29 ? ? H A ASP 33 ? ? 1.49 98 20 O A VAL 47 ? ? H A ILE 89 ? ? 1.56 99 20 O A PHE 25 ? ? N A ASP 27 ? ? 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -172.23 -77.98 2 1 ASN A 4 ? ? -69.44 -81.84 3 1 ASP A 27 ? ? 62.47 -17.92 4 1 ARG A 32 ? ? -145.37 49.11 5 1 LEU A 42 ? ? -33.12 -75.74 6 1 ASP A 43 ? ? -166.07 114.41 7 1 GLU A 44 ? ? 81.14 -24.18 8 1 LEU A 61 ? ? -124.89 -89.87 9 1 THR A 62 ? ? -95.50 -72.70 10 1 THR A 63 ? ? 73.34 -3.00 11 1 LEU A 79 ? ? -48.42 -70.25 12 1 SER A 83 ? ? -67.98 -167.91 13 2 ALA A 2 ? ? 44.56 -164.84 14 2 GLU A 3 ? ? 60.92 165.56 15 2 ASP A 27 ? ? 64.18 -26.49 16 2 ARG A 32 ? ? -151.05 44.80 17 2 LEU A 42 ? ? -51.74 -75.44 18 2 ASP A 43 ? ? -98.00 -118.88 19 2 LEU A 49 ? ? -60.70 0.11 20 2 LEU A 61 ? ? -142.33 -85.40 21 2 PHE A 65 ? ? -36.72 -39.94 22 2 LYS A 76 ? ? 179.90 53.53 23 2 MET A 80 ? ? -165.08 -161.75 24 3 ALA A 2 ? ? 59.69 -176.46 25 3 GLU A 3 ? ? 49.84 -168.96 26 3 ASN A 4 ? ? -55.08 -171.32 27 3 ASP A 6 ? ? 66.11 129.02 28 3 ASN A 7 ? ? -140.86 -66.27 29 3 ASP A 27 ? ? 164.67 -17.12 30 3 ARG A 32 ? ? -148.47 54.42 31 3 LEU A 42 ? ? -47.19 -76.90 32 3 ASP A 43 ? ? -93.11 -116.96 33 3 LEU A 49 ? ? -60.07 0.22 34 3 LEU A 61 ? ? -130.43 -77.97 35 3 THR A 62 ? ? -103.52 -74.05 36 3 LYS A 76 ? ? -156.25 48.94 37 3 GLU A 78 ? ? 34.28 83.75 38 3 LEU A 79 ? ? -153.73 -3.09 39 3 SER A 83 ? ? -59.55 -178.47 40 3 THR A 87 ? ? -145.76 34.51 41 4 ASN A 4 ? ? -105.62 64.25 42 4 ASP A 6 ? ? -62.47 -97.97 43 4 ASN A 7 ? ? 62.57 -71.24 44 4 ASP A 27 ? ? 161.51 -18.54 45 4 ARG A 32 ? ? -152.32 50.07 46 4 LEU A 42 ? ? -54.12 -91.62 47 4 ASP A 43 ? ? -71.35 -131.22 48 4 LEU A 49 ? ? -61.45 0.18 49 4 LEU A 61 ? ? -124.71 -100.90 50 4 ASP A 64 ? ? -61.97 98.19 51 4 GLU A 78 ? ? 24.87 44.61 52 4 LEU A 79 ? ? -82.77 -79.74 53 4 SER A 83 ? ? -62.97 -177.51 54 5 ALA A 2 ? ? -75.42 -142.74 55 5 GLU A 3 ? ? 65.03 96.91 56 5 ASP A 6 ? ? -172.20 122.43 57 5 ASN A 7 ? ? -128.48 -53.75 58 5 ASP A 27 ? ? 162.79 -18.55 59 5 ARG A 32 ? ? -148.31 50.54 60 5 ASP A 43 ? ? -136.23 -121.25 61 5 LEU A 49 ? ? -57.84 -0.10 62 5 LEU A 61 ? ? -137.64 -136.78 63 5 THR A 62 ? ? -41.95 -87.55 64 5 LYS A 76 ? ? -140.84 40.36 65 5 GLU A 78 ? ? 28.93 39.01 66 5 LEU A 79 ? ? -91.04 -75.51 67 5 MET A 80 ? ? -87.91 -159.77 68 5 SER A 83 ? ? -64.71 -165.56 69 6 ASN A 4 ? ? -61.44 -145.14 70 6 ASP A 6 ? ? -133.76 -158.93 71 6 ASN A 7 ? ? 60.40 -82.67 72 6 ASP A 27 ? ? 63.01 -16.63 73 6 ARG A 32 ? ? -151.56 47.96 74 6 LEU A 42 ? ? -42.26 -82.10 75 6 ASP A 43 ? ? -86.16 -122.81 76 6 LEU A 61 ? ? -114.06 -88.28 77 6 THR A 63 ? ? -150.42 15.87 78 6 PHE A 65 ? ? -36.60 -38.29 79 6 LYS A 76 ? ? -157.14 39.86 80 6 GLU A 78 ? ? 54.86 -176.74 81 6 LEU A 79 ? ? 77.68 -17.97 82 6 SER A 83 ? ? -56.05 175.96 83 6 THR A 87 ? ? -149.80 17.19 84 7 ALA A 2 ? ? -159.08 81.55 85 7 ASP A 6 ? ? -59.73 -149.45 86 7 ASN A 7 ? ? -159.87 23.74 87 7 ASP A 27 ? ? 163.81 -19.08 88 7 ASP A 33 ? ? -60.03 97.68 89 7 LEU A 42 ? ? -49.95 -82.40 90 7 ASP A 43 ? ? -81.11 -127.66 91 7 LEU A 49 ? ? -59.70 0.46 92 7 LEU A 61 ? ? -76.67 -95.20 93 7 ASP A 64 ? ? -66.15 98.89 94 7 PHE A 65 ? ? -35.91 -37.06 95 7 GLU A 78 ? ? 44.33 -83.59 96 7 LEU A 79 ? ? -23.99 -69.66 97 7 THR A 87 ? ? -150.42 19.05 98 8 ALA A 2 ? ? -129.85 -152.60 99 8 GLU A 3 ? ? -59.77 176.53 100 8 ASN A 4 ? ? -171.27 39.31 101 8 ASP A 27 ? ? 57.54 -14.51 102 8 ARG A 32 ? ? -153.08 2.53 103 8 ASP A 33 ? ? -60.37 98.73 104 8 LEU A 42 ? ? -52.06 -90.96 105 8 ASP A 43 ? ? -71.39 -132.25 106 8 GLU A 44 ? ? -104.99 48.29 107 8 LEU A 49 ? ? -58.71 -0.04 108 8 LEU A 61 ? ? -131.85 -81.35 109 8 LYS A 76 ? ? -151.66 54.89 110 8 SER A 83 ? ? -65.65 -169.02 111 9 ALA A 2 ? ? 44.95 26.59 112 9 GLU A 3 ? ? 56.02 -165.66 113 9 ASP A 6 ? ? 46.37 -142.13 114 9 ASP A 27 ? ? 56.76 -11.50 115 9 ARG A 32 ? ? -141.65 -4.92 116 9 LEU A 42 ? ? -23.29 -67.29 117 9 ASP A 43 ? ? -167.36 102.54 118 9 LEU A 49 ? ? -57.67 -0.42 119 9 LEU A 61 ? ? -104.25 -71.50 120 9 LYS A 76 ? ? -170.81 58.66 121 9 GLU A 78 ? ? 57.13 15.40 122 9 SER A 83 ? ? -53.54 -172.98 123 10 ALA A 2 ? ? 52.22 -146.09 124 10 ASN A 4 ? ? 35.88 79.75 125 10 ASP A 6 ? ? 66.50 163.34 126 10 ASP A 27 ? ? 166.11 -21.62 127 10 ARG A 32 ? ? -144.22 -0.21 128 10 ASP A 33 ? ? -60.55 98.00 129 10 LEU A 42 ? ? -41.37 -75.69 130 10 ASP A 43 ? ? -93.79 -118.06 131 10 LEU A 61 ? ? -136.60 -90.03 132 10 LYS A 76 ? ? -150.67 46.99 133 10 GLU A 78 ? ? 48.40 -171.49 134 10 LEU A 79 ? ? 64.39 -6.09 135 10 SER A 83 ? ? -63.79 -164.79 136 11 ALA A 2 ? ? -172.62 89.15 137 11 GLU A 3 ? ? 46.25 -167.32 138 11 ASN A 7 ? ? 56.19 111.37 139 11 ASP A 27 ? ? 158.42 -21.32 140 11 ASP A 33 ? ? -60.76 97.88 141 11 LEU A 42 ? ? -32.13 -74.77 142 11 GLU A 44 ? ? 75.41 -26.54 143 11 LEU A 49 ? ? -55.53 0.77 144 11 LEU A 61 ? ? -137.73 -83.24 145 11 ALA A 77 ? ? -67.70 15.85 146 11 GLU A 78 ? ? -39.89 -24.55 147 11 LEU A 79 ? ? -78.32 20.55 148 11 MET A 80 ? ? -176.34 -162.30 149 11 LYS A 86 ? ? 71.14 55.67 150 11 THR A 87 ? ? -178.12 28.87 151 12 GLU A 3 ? ? 172.64 147.24 152 12 ASP A 27 ? ? 162.58 -36.29 153 12 LEU A 42 ? ? -36.77 -77.91 154 12 GLU A 44 ? ? 72.87 -26.53 155 12 LEU A 49 ? ? -54.30 -0.36 156 12 LEU A 61 ? ? -122.31 -68.57 157 12 THR A 63 ? ? -141.70 13.80 158 12 PHE A 65 ? ? -36.53 -39.17 159 12 GLU A 78 ? ? -35.31 -31.33 160 12 SER A 83 ? ? -50.20 174.04 161 12 THR A 87 ? ? -154.58 18.54 162 13 ASP A 27 ? ? 162.26 -27.32 163 13 ASP A 33 ? ? -60.54 98.95 164 13 LEU A 42 ? ? -29.88 -72.28 165 13 GLU A 44 ? ? 76.03 -4.14 166 13 LEU A 49 ? ? -64.87 0.06 167 13 LEU A 61 ? ? -139.23 -71.20 168 13 ALA A 77 ? ? -69.31 15.68 169 13 MET A 80 ? ? -177.25 -162.38 170 13 THR A 87 ? ? -145.43 24.02 171 14 ALA A 2 ? ? 54.30 -178.90 172 14 ASP A 27 ? ? 59.37 -22.00 173 14 ARG A 32 ? ? -144.28 -5.41 174 14 ASP A 33 ? ? -61.15 98.56 175 14 LEU A 42 ? ? -40.43 -77.78 176 14 ASP A 43 ? ? -89.63 -111.01 177 14 LEU A 61 ? ? -118.57 -73.91 178 14 LYS A 76 ? ? -178.99 61.01 179 14 LEU A 79 ? ? -152.73 3.51 180 14 SER A 83 ? ? -59.75 -170.41 181 15 ASN A 7 ? ? 63.70 75.76 182 15 ASP A 27 ? ? 60.62 -15.28 183 15 ASP A 33 ? ? -60.07 98.27 184 15 LEU A 42 ? ? -48.47 -79.20 185 15 ASP A 43 ? ? -84.42 -128.54 186 15 GLU A 44 ? ? -105.38 49.33 187 15 LEU A 49 ? ? -62.88 0.50 188 15 LEU A 61 ? ? -131.63 -135.47 189 15 THR A 62 ? ? -41.15 -85.57 190 15 THR A 63 ? ? 73.05 -1.03 191 15 GLU A 78 ? ? -52.81 84.61 192 15 SER A 83 ? ? -62.32 -169.94 193 15 THR A 87 ? ? -148.78 24.87 194 16 ASP A 6 ? ? 60.23 124.31 195 16 ASP A 27 ? ? 58.28 -18.94 196 16 ARG A 32 ? ? -149.32 -3.17 197 16 ASP A 33 ? ? -60.20 99.19 198 16 LEU A 42 ? ? -45.64 -77.50 199 16 ASP A 43 ? ? -89.29 -115.65 200 16 LEU A 61 ? ? -133.44 -129.84 201 16 THR A 63 ? ? -141.19 10.07 202 16 PHE A 65 ? ? -36.06 -39.84 203 16 GLU A 78 ? ? -45.48 90.43 204 16 MET A 80 ? ? -102.41 -164.27 205 16 SER A 83 ? ? -63.53 -167.58 206 17 ALA A 2 ? ? -151.66 -55.24 207 17 GLU A 3 ? ? -68.71 58.63 208 17 ASN A 4 ? ? -160.53 -61.10 209 17 ASP A 6 ? ? -179.16 104.73 210 17 ASP A 27 ? ? 61.86 -21.86 211 17 ARG A 32 ? ? -144.82 -0.95 212 17 ASP A 33 ? ? -60.31 98.67 213 17 LEU A 42 ? ? -48.82 -79.89 214 17 ASP A 43 ? ? -89.37 -122.50 215 17 LEU A 61 ? ? -135.38 -88.58 216 17 THR A 63 ? ? 176.75 -25.71 217 17 LYS A 76 ? ? -151.39 39.82 218 17 GLU A 78 ? ? 41.34 27.33 219 17 THR A 87 ? ? -153.88 17.49 220 18 ALA A 2 ? ? 63.56 67.65 221 18 GLU A 3 ? ? 177.24 72.19 222 18 ASN A 4 ? ? -85.15 -73.61 223 18 ASP A 27 ? ? 171.19 -21.23 224 18 ARG A 32 ? ? -154.41 20.29 225 18 ASP A 33 ? ? -59.69 98.13 226 18 LEU A 42 ? ? -56.36 -78.43 227 18 ASP A 43 ? ? -83.14 -133.21 228 18 LEU A 49 ? ? -62.35 0.55 229 18 LEU A 61 ? ? -95.86 -143.24 230 18 THR A 63 ? ? -142.43 11.75 231 18 GLU A 78 ? ? 29.81 38.08 232 18 LEU A 79 ? ? -51.65 -90.64 233 19 ALA A 2 ? ? -175.05 122.77 234 19 GLU A 3 ? ? -61.99 79.83 235 19 ASP A 27 ? ? 58.67 -15.52 236 19 ASP A 33 ? ? -60.46 98.80 237 19 LEU A 42 ? ? -44.15 -83.26 238 19 ASP A 43 ? ? -88.12 -121.65 239 19 GLU A 44 ? ? -106.09 43.95 240 19 LEU A 61 ? ? -124.28 -96.75 241 19 GLU A 78 ? ? 62.98 -85.91 242 19 MET A 80 ? ? 63.96 -173.05 243 19 SER A 83 ? ? -48.26 179.47 244 19 LYS A 86 ? ? 69.73 60.96 245 19 THR A 87 ? ? -157.40 19.75 246 20 ALA A 2 ? ? -92.37 -73.12 247 20 ASN A 4 ? ? -79.72 -78.12 248 20 ASP A 6 ? ? -179.24 147.54 249 20 ASP A 27 ? ? 58.26 -16.50 250 20 ARG A 32 ? ? -141.68 -7.86 251 20 LEU A 42 ? ? -32.61 -76.32 252 20 GLU A 44 ? ? 73.75 -27.25 253 20 TRP A 46 ? ? -59.10 105.12 254 20 LEU A 49 ? ? -53.51 0.22 255 20 LEU A 61 ? ? -141.58 -153.79 256 20 LYS A 76 ? ? -155.94 51.06 257 20 GLU A 78 ? ? 45.73 -174.31 258 20 LEU A 79 ? ? 61.93 -3.31 259 20 SER A 83 ? ? -58.41 177.13 260 20 THR A 87 ? ? -155.86 16.87 # _pdbx_nmr_ensemble.entry_id 1S7A _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1S7A _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8 mM La motif U-15N,13C; 20 mM Tris-HCl, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM KCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1S7A _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.1 'structure solution' Brunger 1 VNMR 1c collection Varian 2 NMRPipe 1 processing Delaglio 3 TALOS 1999.019.15.47 'data analysis' Bax 4 MOLMOL 2.6 'data analysis' Wuthrich 5 XEASY 6600 'data analysis' Wuthrich 6 X-PLOR 3.1 refinement Brunger 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian INOVA 800 # _atom_sites.entry_id 1S7A _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #