data_1SFV # _entry.id 1SFV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SFV pdb_00001sfv 10.2210/pdb1sfv/pdb WWPDB D_1000176356 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1SFW _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SFV _pdbx_database_status.recvd_initial_deposition_date 1996-02-20 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Van Den Berg, B.' 1 'Tessari, M.' 2 'Boelens, R.' 3 'Dijkman, R.' 4 'Kaptein, R.' 5 'De Haas, G.H.' 6 'Verheij, H.M.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of porcine pancreatic phospholipase A2 complexed with micelles and a competitive inhibitor.' J.Biomol.NMR 5 110 121 1995 JBNME9 NE 0925-2738 0800 ? 7703697 10.1007/BF00208802 1 'Solution Structure of Porcine Pancreatic Phospholipase A2' 'Embo J.' 14 4123 ? 1995 EMJODG UK 0261-4189 0897 ? ? ? 2 'NMR Structures of Phospholipase A2 Reveal Conformational Changes During Interfacial Activation' Nat.Struct.Biol. 2 402 ? 1995 NSBIEW US 1072-8368 2024 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'van den Berg, B.' 1 ? primary 'Tessari, M.' 2 ? primary 'Boelens, R.' 3 ? primary 'Dijkman, R.' 4 ? primary 'Kaptein, R.' 5 ? primary 'de Haas, G.H.' 6 ? primary 'Verheij, H.M.' 7 ? 1 'Van Den Berg, B.' 8 ? 1 'Tessari, M.' 9 ? 1 'De Haas, G.H.' 10 ? 1 'Verheij, H.M.' 11 ? 1 'Boelens, R.' 12 ? 1 'Kaptein, R.' 13 ? 2 'Van Den Berg, B.' 14 ? 2 'Tessari, M.' 15 ? 2 'Boelens, R.' 16 ? 2 'Dijkman, R.' 17 ? 2 'De Haas, G.H.' 18 ? 2 'Kaptein, R.' 19 ? 2 'Verheij, H.M.' 20 ? # _cell.entry_id 1SFV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SFV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PHOSPHOLIPASE A2' 14009.714 1 3.1.1.4 ? ? 'THIS ENTRY PRESENTS THE SOLUTION STRUCTURE OF THE ENZYME IN THE PRESENCE OF LIPID MICELLES AND A COMPETITIVE INHIBITOR' 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PLA2, PHOSPHATIDYLCHOLINE 2-ACYLHYDROLASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNT EITCNSKNNACEAFICNCDRNAAICFSKAPYNKEHKNLDTKKYC ; _entity_poly.pdbx_seq_one_letter_code_can ;ALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNT EITCNSKNNACEAFICNCDRNAAICFSKAPYNKEHKNLDTKKYC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LEU n 1 3 TRP n 1 4 GLN n 1 5 PHE n 1 6 ARG n 1 7 SER n 1 8 MET n 1 9 ILE n 1 10 LYS n 1 11 CYS n 1 12 ALA n 1 13 ILE n 1 14 PRO n 1 15 GLY n 1 16 SER n 1 17 HIS n 1 18 PRO n 1 19 LEU n 1 20 MET n 1 21 ASP n 1 22 PHE n 1 23 ASN n 1 24 ASN n 1 25 TYR n 1 26 GLY n 1 27 CYS n 1 28 TYR n 1 29 CYS n 1 30 GLY n 1 31 LEU n 1 32 GLY n 1 33 GLY n 1 34 SER n 1 35 GLY n 1 36 THR n 1 37 PRO n 1 38 VAL n 1 39 ASP n 1 40 GLU n 1 41 LEU n 1 42 ASP n 1 43 ARG n 1 44 CYS n 1 45 CYS n 1 46 GLU n 1 47 THR n 1 48 HIS n 1 49 ASP n 1 50 ASN n 1 51 CYS n 1 52 TYR n 1 53 ARG n 1 54 ASP n 1 55 ALA n 1 56 LYS n 1 57 ASN n 1 58 LEU n 1 59 ASP n 1 60 SER n 1 61 CYS n 1 62 LYS n 1 63 PHE n 1 64 LEU n 1 65 VAL n 1 66 ASP n 1 67 ASN n 1 68 PRO n 1 69 TYR n 1 70 THR n 1 71 GLU n 1 72 SER n 1 73 TYR n 1 74 SER n 1 75 TYR n 1 76 SER n 1 77 CYS n 1 78 SER n 1 79 ASN n 1 80 THR n 1 81 GLU n 1 82 ILE n 1 83 THR n 1 84 CYS n 1 85 ASN n 1 86 SER n 1 87 LYS n 1 88 ASN n 1 89 ASN n 1 90 ALA n 1 91 CYS n 1 92 GLU n 1 93 ALA n 1 94 PHE n 1 95 ILE n 1 96 CYS n 1 97 ASN n 1 98 CYS n 1 99 ASP n 1 100 ARG n 1 101 ASN n 1 102 ALA n 1 103 ALA n 1 104 ILE n 1 105 CYS n 1 106 PHE n 1 107 SER n 1 108 LYS n 1 109 ALA n 1 110 PRO n 1 111 TYR n 1 112 ASN n 1 113 LYS n 1 114 GLU n 1 115 HIS n 1 116 LYS n 1 117 ASN n 1 118 LEU n 1 119 ASP n 1 120 THR n 1 121 LYS n 1 122 LYS n 1 123 TYR n 1 124 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name pig _entity_src_gen.gene_src_genus Sus _entity_src_gen.pdbx_gene_src_gene 'PORCINE PANCREAS PLA2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sus scrofa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ PANCREAS _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene 'PORCINE PANCREAS PLA2' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PAB3 (PGEX T2 DERIVED EXPRESSION PLASMID)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'DETAILS CONCERNING THE EXPRESSION OF THE PLA2 CAN BE FOUND IN REFERENCES BELOW' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PA21B_PIG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00592 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKFLVLAVLLTVGAAQEGISSRALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDNCYRDAKNL DSCKFLVDNPYTESYSYSCSNTEITCNSKNNACEAFICNCDRNAAICFSKAPYNKEHKNLDTKKYC ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SFV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00592 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1SFV _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name Discover _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BIOSYM _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1SFV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1SFV _struct.title 'PORCINE PANCREAS PHOSPHOLIPASE A2, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SFV _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'PHOSPHOLIPASE A2, PHOSPHATIDE-2-ACYL-HYDROLASE, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 2 ? ALA A 12 ? LEU A 2 ALA A 12 1 ? 11 HELX_P HELX_P2 2 GLU A 40 ? ASN A 50 ? GLU A 40 ASN A 50 1 ? 11 HELX_P HELX_P3 3 ARG A 53 ? ALA A 55 ? ARG A 53 ALA A 55 5 ? 3 HELX_P HELX_P4 4 ALA A 93 ? PHE A 106 ? ALA A 93 PHE A 106 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 77 SG ? ? A CYS 11 A CYS 77 1_555 ? ? ? ? ? ? ? 1.999 ? ? disulf2 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 124 SG ? ? A CYS 27 A CYS 124 1_555 ? ? ? ? ? ? ? 1.973 ? ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 29 A CYS 45 1_555 ? ? ? ? ? ? ? 1.994 ? ? disulf4 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 105 SG ? ? A CYS 44 A CYS 105 1_555 ? ? ? ? ? ? ? 1.994 ? ? disulf5 disulf ? ? A CYS 51 SG ? ? ? 1_555 A CYS 98 SG ? ? A CYS 51 A CYS 98 1_555 ? ? ? ? ? ? ? 1.995 ? ? disulf6 disulf ? ? A CYS 61 SG ? ? ? 1_555 A CYS 91 SG ? ? A CYS 61 A CYS 91 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf7 disulf ? ? A CYS 84 SG ? ? ? 1_555 A CYS 96 SG ? ? A CYS 84 A CYS 96 1_555 ? ? ? ? ? ? ? 1.979 ? ? metalc1 metalc ? ? A ASP 49 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 49 A CA 125 1_555 ? ? ? ? ? ? ? 3.158 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CA Unknown ? ? ? ? 1 'CATALYTIC CALCIUM ION (COFACTOR).' AC1 Software A CA 125 ? 4 'BINDING SITE FOR RESIDUE CA A 125' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CA 1 CA B . ? CA A 125 . ? 1_555 ? 2 AC1 4 GLY A 30 ? GLY A 30 . ? 1_555 ? 3 AC1 4 LEU A 31 ? LEU A 31 . ? 1_555 ? 4 AC1 4 CYS A 45 ? CYS A 45 . ? 1_555 ? 5 AC1 4 ASP A 49 ? ASP A 49 . ? 1_555 ? # _database_PDB_matrix.entry_id 1SFV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1SFV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 TRP 3 3 3 TRP TRP A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 CYS 98 98 98 CYS CYS A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 CYS 124 124 124 CYS CYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 125 _pdbx_nonpoly_scheme.auth_seq_num 125 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-07-11 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 40 ? ? OE1 A GLU 40 ? ? 1.372 1.252 0.120 0.011 N 2 1 CD A GLU 46 ? ? OE1 A GLU 46 ? ? 1.371 1.252 0.119 0.011 N 3 1 CG A HIS 48 ? ? CD2 A HIS 48 ? ? 1.412 1.354 0.058 0.009 N 4 1 CD A GLU 71 ? ? OE2 A GLU 71 ? ? 1.372 1.252 0.120 0.011 N 5 1 CD A GLU 81 ? ? OE1 A GLU 81 ? ? 1.372 1.252 0.120 0.011 N 6 1 CD A GLU 92 ? ? OE2 A GLU 92 ? ? 1.370 1.252 0.118 0.011 N 7 1 CD A GLU 114 ? ? OE2 A GLU 114 ? ? 1.372 1.252 0.120 0.011 N 8 1 C A CYS 124 ? ? OXT A CYS 124 ? ? 1.374 1.229 0.145 0.019 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 124.74 120.30 4.44 0.50 N 2 1 CB A HIS 17 ? ? CG A HIS 17 ? ? CD2 A HIS 17 ? ? 117.94 129.70 -11.76 1.60 N 3 1 CG A HIS 17 ? ? ND1 A HIS 17 ? ? CE1 A HIS 17 ? ? 97.65 105.70 -8.05 1.30 N 4 1 ND1 A HIS 17 ? ? CE1 A HIS 17 ? ? NE2 A HIS 17 ? ? 120.10 111.50 8.60 1.30 N 5 1 N A MET 20 ? ? CA A MET 20 ? ? CB A MET 20 ? ? 98.25 110.60 -12.35 1.80 N 6 1 CB A ASP 21 ? ? CG A ASP 21 ? ? OD1 A ASP 21 ? ? 112.35 118.30 -5.95 0.90 N 7 1 CB A TYR 28 ? ? CG A TYR 28 ? ? CD2 A TYR 28 ? ? 116.03 121.00 -4.97 0.60 N 8 1 CB A TYR 28 ? ? CG A TYR 28 ? ? CD1 A TYR 28 ? ? 125.68 121.00 4.68 0.60 N 9 1 CB A LEU 31 ? ? CA A LEU 31 ? ? C A LEU 31 ? ? 123.73 110.20 13.53 1.90 N 10 1 CB A ASP 42 ? ? CG A ASP 42 ? ? OD1 A ASP 42 ? ? 123.99 118.30 5.69 0.90 N 11 1 CB A ASP 42 ? ? CG A ASP 42 ? ? OD2 A ASP 42 ? ? 111.47 118.30 -6.83 0.90 N 12 1 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.13 120.30 3.83 0.50 N 13 1 ND1 A HIS 48 ? ? CE1 A HIS 48 ? ? NE2 A HIS 48 ? ? 120.03 111.50 8.53 1.30 N 14 1 CB A ASP 49 ? ? CG A ASP 49 ? ? OD1 A ASP 49 ? ? 124.60 118.30 6.30 0.90 N 15 1 CB A ASP 49 ? ? CG A ASP 49 ? ? OD2 A ASP 49 ? ? 111.26 118.30 -7.04 0.90 N 16 1 NE A ARG 53 ? ? CZ A ARG 53 ? ? NH1 A ARG 53 ? ? 124.35 120.30 4.05 0.50 N 17 1 CB A ASP 54 ? ? CG A ASP 54 ? ? OD2 A ASP 54 ? ? 112.60 118.30 -5.70 0.90 N 18 1 CB A ASP 59 ? ? CG A ASP 59 ? ? OD1 A ASP 59 ? ? 112.18 118.30 -6.12 0.90 N 19 1 CB A LEU 64 ? ? CG A LEU 64 ? ? CD2 A LEU 64 ? ? 100.41 111.00 -10.59 1.70 N 20 1 CB A ASP 66 ? ? CG A ASP 66 ? ? OD2 A ASP 66 ? ? 112.45 118.30 -5.85 0.90 N 21 1 CB A TYR 69 ? ? CG A TYR 69 ? ? CD1 A TYR 69 ? ? 125.08 121.00 4.08 0.60 N 22 1 N A SER 72 ? ? CA A SER 72 ? ? CB A SER 72 ? ? 101.02 110.50 -9.48 1.50 N 23 1 CB A TYR 73 ? ? CG A TYR 73 ? ? CD2 A TYR 73 ? ? 116.02 121.00 -4.98 0.60 N 24 1 N A TYR 75 ? ? CA A TYR 75 ? ? CB A TYR 75 ? ? 99.17 110.60 -11.43 1.80 N 25 1 CB A TYR 75 ? ? CG A TYR 75 ? ? CD2 A TYR 75 ? ? 115.58 121.00 -5.42 0.60 N 26 1 CB A TYR 75 ? ? CG A TYR 75 ? ? CD1 A TYR 75 ? ? 126.37 121.00 5.37 0.60 N 27 1 CB A ILE 82 ? ? CA A ILE 82 ? ? C A ILE 82 ? ? 123.82 111.60 12.22 2.00 N 28 1 N A CYS 84 ? ? CA A CYS 84 ? ? CB A CYS 84 ? ? 122.65 110.80 11.85 1.50 N 29 1 CB A ASP 99 ? ? CG A ASP 99 ? ? OD2 A ASP 99 ? ? 112.51 118.30 -5.79 0.90 N 30 1 NE A ARG 100 ? ? CZ A ARG 100 ? ? NH1 A ARG 100 ? ? 124.69 120.30 4.39 0.50 N 31 1 CB A PHE 106 ? ? CG A PHE 106 ? ? CD2 A PHE 106 ? ? 114.20 120.80 -6.60 0.70 N 32 1 CB A PHE 106 ? ? CG A PHE 106 ? ? CD1 A PHE 106 ? ? 127.58 120.80 6.78 0.70 N 33 1 CB A TYR 111 ? ? CG A TYR 111 ? ? CD2 A TYR 111 ? ? 127.71 121.00 6.71 0.60 N 34 1 CB A TYR 111 ? ? CG A TYR 111 ? ? CD1 A TYR 111 ? ? 112.86 121.00 -8.14 0.60 N 35 1 CB A GLU 114 ? ? CA A GLU 114 ? ? C A GLU 114 ? ? 125.82 110.40 15.42 2.00 N 36 1 CB A HIS 115 ? ? CG A HIS 115 ? ? CD2 A HIS 115 ? ? 117.24 129.70 -12.46 1.60 N 37 1 ND1 A HIS 115 ? ? CE1 A HIS 115 ? ? NE2 A HIS 115 ? ? 119.70 111.50 8.20 1.30 N 38 1 N A LYS 116 ? ? CA A LYS 116 ? ? CB A LYS 116 ? ? 99.03 110.60 -11.57 1.80 N 39 1 N A LYS 122 ? ? CA A LYS 122 ? ? CB A LYS 122 ? ? 97.10 110.60 -13.50 1.80 N 40 1 N A TYR 123 ? ? CA A TYR 123 ? ? CB A TYR 123 ? ? 90.50 110.60 -20.10 1.80 N 41 1 CB A TYR 123 ? ? CG A TYR 123 ? ? CD2 A TYR 123 ? ? 117.34 121.00 -3.66 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 2 ? ? -93.55 -60.56 2 1 SER A 16 ? ? -157.40 -91.96 3 1 LEU A 19 ? ? -72.16 -116.98 4 1 MET A 20 ? ? 4.31 -28.09 5 1 ASP A 21 ? ? -56.46 -4.44 6 1 PHE A 22 ? ? -139.66 -46.29 7 1 TYR A 25 ? ? -168.69 107.44 8 1 TYR A 28 ? ? -160.15 -28.29 9 1 CYS A 29 ? ? -10.85 111.57 10 1 LEU A 31 ? ? -102.63 -82.33 11 1 PRO A 37 ? ? -88.88 -154.05 12 1 VAL A 38 ? ? -131.89 -59.06 13 1 ASP A 49 ? ? 165.58 -60.73 14 1 LEU A 58 ? ? -5.80 139.70 15 1 PHE A 63 ? ? -150.48 -125.04 16 1 LEU A 64 ? ? -92.14 -62.28 17 1 ASN A 67 ? ? -116.08 -80.93 18 1 THR A 70 ? ? -175.19 -46.67 19 1 TYR A 73 ? ? 113.44 134.09 20 1 SER A 74 ? ? -176.23 82.73 21 1 TYR A 75 ? ? -119.78 -137.64 22 1 SER A 76 ? ? -171.06 -179.25 23 1 SER A 78 ? ? -103.94 -128.08 24 1 THR A 80 ? ? -174.98 -30.86 25 1 ILE A 82 ? ? -114.76 -115.83 26 1 THR A 83 ? ? -173.74 -101.34 27 1 CYS A 84 ? ? 177.24 -69.31 28 1 SER A 86 ? ? -145.87 58.57 29 1 LYS A 87 ? ? -160.05 -62.01 30 1 ASN A 88 ? ? 55.77 127.28 31 1 ASN A 89 ? ? -129.25 -123.13 32 1 CYS A 91 ? ? -16.16 -61.47 33 1 LYS A 108 ? ? -138.16 -73.49 34 1 ALA A 109 ? ? 30.77 -166.75 35 1 GLU A 114 ? ? -152.77 -57.67 36 1 ASN A 117 ? ? 93.60 -46.62 37 1 LEU A 118 ? ? 25.86 -151.07 38 1 ASP A 119 ? ? -170.35 -44.50 39 1 THR A 120 ? ? 90.31 60.20 40 1 LYS A 121 ? ? -151.98 -69.48 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 PRO A 14 ? ? GLY A 15 ? ? 123.85 2 1 MET A 20 ? ? ASP A 21 ? ? 134.15 3 1 LEU A 64 ? ? VAL A 65 ? ? -143.37 4 1 SER A 76 ? ? CYS A 77 ? ? 140.70 5 1 ASN A 88 ? ? ASN A 89 ? ? 148.33 6 1 LYS A 113 ? ? GLU A 114 ? ? -136.72 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 PHE A 22 ? ? 0.082 'SIDE CHAIN' 2 1 TYR A 25 ? ? 0.129 'SIDE CHAIN' 3 1 TYR A 28 ? ? 0.089 'SIDE CHAIN' 4 1 TYR A 52 ? ? 0.102 'SIDE CHAIN' 5 1 TYR A 69 ? ? 0.109 'SIDE CHAIN' 6 1 TYR A 73 ? ? 0.137 'SIDE CHAIN' 7 1 TYR A 75 ? ? 0.080 'SIDE CHAIN' 8 1 HIS A 115 ? ? 0.224 'SIDE CHAIN' 9 1 TYR A 123 ? ? 0.073 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #