data_1SG7 # _entry.id 1SG7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SG7 pdb_00001sg7 10.2210/pdb1sg7/pdb RCSB RCSB021685 ? ? WWPDB D_1000021685 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-03-08 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SG7 _pdbx_database_status.recvd_initial_deposition_date 2004-02-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id CHAB_ECO57 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Osborne, M.J.' 1 'Siddiqui, N.' 2 'Cygler, M.' 3 'Gehring, K.' 4 'Montreal-Kingston Bacterial Structural Genomics Initiative (BSGI)' 5 # _citation.id primary _citation.title 'The solution structure of ChaB, a putative membrane ion antiporter regulator from Escherichia coli' _citation.journal_abbrev 'BMC STRUCT.BIOL.' _citation.journal_volume 4 _citation.page_first 9 _citation.page_last ? _citation.year 2004 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1472-6807 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15306028 _citation.pdbx_database_id_DOI 10.1186/1472-6807-4-9 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Osborne, M.J.' 1 ? primary 'Siddiqui, N.' 2 ? primary 'Iannuzzi, P.' 3 ? primary 'Gehring, K.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative Cation transport regulator chaB' _entity.formula_weight 11192.171 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHHHSSGFNPRGSPYKTKSDLPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAV KHEYAKGDDDKWHKKS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHHHSSGFNPRGSPYKTKSDLPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAV KHEYAKGDDDKWHKKS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CHAB_ECO57 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 SER n 1 14 SER n 1 15 GLY n 1 16 PHE n 1 17 ASN n 1 18 PRO n 1 19 ARG n 1 20 GLY n 1 21 SER n 1 22 PRO n 1 23 TYR n 1 24 LYS n 1 25 THR n 1 26 LYS n 1 27 SER n 1 28 ASP n 1 29 LEU n 1 30 PRO n 1 31 GLU n 1 32 SER n 1 33 VAL n 1 34 LYS n 1 35 HIS n 1 36 VAL n 1 37 LEU n 1 38 PRO n 1 39 SER n 1 40 HIS n 1 41 ALA n 1 42 GLN n 1 43 ASP n 1 44 ILE n 1 45 TYR n 1 46 LYS n 1 47 GLU n 1 48 ALA n 1 49 PHE n 1 50 ASN n 1 51 SER n 1 52 ALA n 1 53 TRP n 1 54 ASP n 1 55 GLN n 1 56 TYR n 1 57 LYS n 1 58 ASP n 1 59 LYS n 1 60 GLU n 1 61 ASP n 1 62 ARG n 1 63 ARG n 1 64 ASP n 1 65 ASP n 1 66 ALA n 1 67 SER n 1 68 ARG n 1 69 GLU n 1 70 GLU n 1 71 THR n 1 72 ALA n 1 73 HIS n 1 74 LYS n 1 75 VAL n 1 76 ALA n 1 77 TRP n 1 78 ALA n 1 79 ALA n 1 80 VAL n 1 81 LYS n 1 82 HIS n 1 83 GLU n 1 84 TYR n 1 85 ALA n 1 86 LYS n 1 87 GLY n 1 88 ASP n 1 89 ASP n 1 90 ASP n 1 91 LYS n 1 92 TRP n 1 93 HIS n 1 94 LYS n 1 95 LYS n 1 96 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene CHAB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 GOLD (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet-15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 HIS 11 11 ? ? ? A . n A 1 12 HIS 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 SER 14 14 ? ? ? A . n A 1 15 GLY 15 15 ? ? ? A . n A 1 16 PHE 16 16 ? ? ? A . n A 1 17 ASN 17 17 ? ? ? A . n A 1 18 PRO 18 18 ? ? ? A . n A 1 19 ARG 19 19 ? ? ? A . n A 1 20 GLY 20 20 ? ? ? A . n A 1 21 SER 21 21 ? ? ? A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 SER 96 96 96 SER SER A . n # _cell.entry_id 1SG7 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SG7 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1SG7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1SG7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1SG7 _struct.title 'NMR solution structure of the putative cation transport regulator ChaB' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SG7 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'STRUCTURAL GENOMICS, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CHAB_ECOLI _struct_ref.pdbx_db_accession P39162 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PYKTKSDLPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAVKHEYAKGDDDKWHKKS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SG7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 96 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P39162 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 75 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 22 _struct_ref_seq.pdbx_auth_seq_align_end 96 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1SG7 MET A 1 ? UNP P39162 ? ? 'initiating methionine' 1 1 1 1SG7 GLY A 2 ? UNP P39162 ? ? 'cloning artifact' 2 2 1 1SG7 SER A 3 ? UNP P39162 ? ? 'cloning artifact' 3 3 1 1SG7 SER A 4 ? UNP P39162 ? ? 'cloning artifact' 4 4 1 1SG7 HIS A 5 ? UNP P39162 ? ? 'expression tag' 5 5 1 1SG7 HIS A 6 ? UNP P39162 ? ? 'expression tag' 6 6 1 1SG7 HIS A 7 ? UNP P39162 ? ? 'expression tag' 7 7 1 1SG7 HIS A 8 ? UNP P39162 ? ? 'expression tag' 8 8 1 1SG7 HIS A 9 ? UNP P39162 ? ? 'expression tag' 9 9 1 1SG7 HIS A 10 ? UNP P39162 ? ? 'expression tag' 10 10 1 1SG7 HIS A 11 ? UNP P39162 ? ? 'expression tag' 11 11 1 1SG7 HIS A 12 ? UNP P39162 ? ? 'expression tag' 12 12 1 1SG7 SER A 13 ? UNP P39162 ? ? 'cloning artifact' 13 13 1 1SG7 SER A 14 ? UNP P39162 ? ? 'cloning artifact' 14 14 1 1SG7 GLY A 15 ? UNP P39162 ? ? 'cloning artifact' 15 15 1 1SG7 PHE A 16 ? UNP P39162 ? ? 'cloning artifact' 16 16 1 1SG7 ASN A 17 ? UNP P39162 ? ? 'cloning artifact' 17 17 1 1SG7 PRO A 18 ? UNP P39162 ? ? 'cloning artifact' 18 18 1 1SG7 ARG A 19 ? UNP P39162 ? ? 'cloning artifact' 19 19 1 1SG7 GLY A 20 ? UNP P39162 ? ? 'cloning artifact' 20 20 1 1SG7 SER A 21 ? UNP P39162 ? ? 'cloning artifact' 21 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 30 ? HIS A 35 ? PRO A 30 HIS A 35 1 ? 6 HELX_P HELX_P2 2 SER A 39 ? TYR A 56 ? SER A 39 TYR A 56 1 ? 18 HELX_P HELX_P3 3 ASP A 64 ? GLU A 83 ? ASP A 64 GLU A 83 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 84 ? LYS A 86 ? TYR A 84 LYS A 86 A 2 TRP A 92 ? LYS A 94 ? TRP A 92 LYS A 94 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 85 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 85 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id HIS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 93 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id HIS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 93 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A TRP 77 ? ? H A LYS 81 ? ? 1.52 2 1 H A ALA 85 ? ? O A HIS 93 ? ? 1.59 3 2 O A TRP 77 ? ? H A LYS 81 ? ? 1.49 4 2 O A ALA 66 ? ? H A GLU 70 ? ? 1.56 5 2 O A VAL 80 ? ? H A TYR 84 ? ? 1.59 6 3 O A TRP 77 ? ? H A LYS 81 ? ? 1.53 7 3 O A ALA 41 ? ? H A TYR 45 ? ? 1.58 8 4 O A TRP 77 ? ? H A LYS 81 ? ? 1.53 9 5 O A TRP 77 ? ? H A LYS 81 ? ? 1.53 10 5 O A ALA 66 ? ? H A GLU 70 ? ? 1.55 11 6 O A TRP 77 ? ? H A LYS 81 ? ? 1.50 12 6 O A ALA 66 ? ? H A GLU 70 ? ? 1.57 13 7 O A TRP 77 ? ? H A LYS 81 ? ? 1.56 14 7 H A ALA 85 ? ? O A HIS 93 ? ? 1.56 15 8 O A TRP 77 ? ? H A LYS 81 ? ? 1.52 16 8 O A ALA 66 ? ? H A GLU 70 ? ? 1.57 17 8 O A ALA 41 ? ? H A TYR 45 ? ? 1.58 18 9 O A TRP 77 ? ? H A LYS 81 ? ? 1.55 19 9 O A ALA 66 ? ? H A GLU 70 ? ? 1.60 20 10 O A TRP 77 ? ? H A LYS 81 ? ? 1.54 21 11 O A TRP 77 ? ? H A LYS 81 ? ? 1.53 22 11 H A ALA 85 ? ? O A HIS 93 ? ? 1.58 23 12 O A TRP 77 ? ? H A LYS 81 ? ? 1.53 24 12 O A SER 67 ? ? H A THR 71 ? ? 1.58 25 13 O A TRP 77 ? ? H A LYS 81 ? ? 1.50 26 13 O A ALA 66 ? ? H A GLU 70 ? ? 1.58 27 13 O A GLU 83 ? ? H A LYS 95 ? ? 1.59 28 14 O A TRP 77 ? ? H A LYS 81 ? ? 1.53 29 14 O A SER 67 ? ? H A THR 71 ? ? 1.60 30 15 O A TRP 77 ? ? H A LYS 81 ? ? 1.54 31 15 O A ALA 66 ? ? H A GLU 70 ? ? 1.59 32 16 O A TRP 77 ? ? H A LYS 81 ? ? 1.55 33 17 O A TRP 77 ? ? H A LYS 81 ? ? 1.52 34 17 O A ALA 66 ? ? H A GLU 70 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 25 ? ? -125.85 -56.10 2 1 LYS A 26 ? ? 178.70 -52.76 3 1 VAL A 36 ? ? -142.42 -31.54 4 1 PRO A 38 ? ? -55.85 -79.65 5 1 SER A 39 ? ? -149.38 -79.48 6 1 LYS A 59 ? ? -106.49 40.92 7 1 ASP A 64 ? ? -91.27 48.62 8 1 ASP A 88 ? ? -84.99 32.54 9 1 ASP A 89 ? ? -131.74 -87.95 10 1 ASP A 90 ? ? -171.18 27.45 11 1 LYS A 95 ? ? -80.73 -81.26 12 2 THR A 25 ? ? -125.05 -61.98 13 2 LYS A 26 ? ? -179.34 -51.35 14 2 VAL A 36 ? ? -143.08 -32.65 15 2 PRO A 38 ? ? -60.18 -169.44 16 2 SER A 39 ? ? -57.22 -80.79 17 2 LYS A 59 ? ? -93.04 34.50 18 2 ASP A 64 ? ? -84.24 48.46 19 2 ASP A 88 ? ? -86.73 32.13 20 2 ASP A 89 ? ? -126.93 -81.44 21 2 ASP A 90 ? ? -179.93 28.78 22 2 LYS A 95 ? ? -81.40 -82.11 23 3 THR A 25 ? ? -125.05 -59.31 24 3 LYS A 26 ? ? 176.71 -48.42 25 3 VAL A 36 ? ? -149.91 -34.71 26 3 PRO A 38 ? ? -54.67 -83.78 27 3 SER A 39 ? ? -148.16 -74.18 28 3 ASP A 64 ? ? -92.70 47.91 29 3 ASP A 88 ? ? -67.59 27.74 30 3 ASP A 89 ? ? -144.49 -155.99 31 3 LYS A 95 ? ? -81.88 -80.75 32 4 THR A 25 ? ? -125.23 -57.44 33 4 LYS A 26 ? ? 174.25 -50.95 34 4 VAL A 36 ? ? -142.66 -32.39 35 4 SER A 39 ? ? -52.73 -74.95 36 4 LYS A 59 ? ? -95.15 35.47 37 4 ASP A 64 ? ? -79.78 43.96 38 4 ASP A 88 ? ? -84.69 31.08 39 4 ASP A 89 ? ? -128.11 -83.25 40 4 ASP A 90 ? ? -177.70 27.74 41 4 LYS A 95 ? ? -82.53 -81.89 42 5 THR A 25 ? ? -125.42 -64.09 43 5 LYS A 26 ? ? -179.15 -49.05 44 5 VAL A 36 ? ? -144.87 -27.50 45 5 PRO A 38 ? ? -56.57 -83.19 46 5 SER A 39 ? ? -148.12 -74.40 47 5 LYS A 59 ? ? -99.00 45.94 48 5 ASP A 64 ? ? -87.36 45.93 49 5 ASP A 88 ? ? -83.10 33.11 50 5 ASP A 89 ? ? -127.89 -84.14 51 5 ASP A 90 ? ? -177.52 29.10 52 5 LYS A 95 ? ? -80.29 -82.48 53 6 THR A 25 ? ? -125.62 -61.56 54 6 LYS A 26 ? ? -179.04 -50.82 55 6 VAL A 36 ? ? -158.26 -34.44 56 6 PRO A 38 ? ? -60.01 -175.40 57 6 SER A 39 ? ? -56.41 -75.34 58 6 ASP A 64 ? ? -89.30 48.56 59 6 ASP A 88 ? ? -66.01 25.01 60 6 LYS A 95 ? ? -81.02 -82.01 61 7 THR A 25 ? ? -125.06 -58.26 62 7 LYS A 26 ? ? 176.73 -47.87 63 7 VAL A 36 ? ? -154.10 -31.80 64 7 PRO A 38 ? ? -55.07 -75.73 65 7 SER A 39 ? ? -156.09 -71.00 66 7 LYS A 59 ? ? -175.27 42.09 67 7 ARG A 62 ? ? -99.16 -114.68 68 7 ASP A 64 ? ? -92.56 54.00 69 7 ASP A 88 ? ? -67.10 25.75 70 7 ASP A 89 ? ? -143.26 -156.53 71 8 THR A 25 ? ? -125.50 -58.65 72 8 LYS A 26 ? ? -178.45 -50.90 73 8 VAL A 36 ? ? -149.18 -33.16 74 8 PRO A 38 ? ? -61.07 -179.59 75 8 SER A 39 ? ? -53.19 -75.84 76 8 TYR A 56 ? ? -70.62 47.19 77 8 LYS A 59 ? ? -174.79 48.22 78 8 ASP A 61 ? ? -107.32 43.38 79 8 ARG A 62 ? ? -106.46 -117.74 80 8 ASP A 64 ? ? -98.14 54.51 81 8 ASP A 88 ? ? -66.94 29.55 82 8 ASP A 89 ? ? -148.03 -159.04 83 8 LYS A 95 ? ? -80.36 -81.83 84 9 THR A 25 ? ? -125.58 -58.60 85 9 LYS A 26 ? ? 176.06 -49.04 86 9 VAL A 36 ? ? -145.62 -29.05 87 9 PRO A 38 ? ? -58.12 -97.52 88 9 SER A 39 ? ? -128.27 -76.17 89 9 LYS A 59 ? ? -164.95 52.08 90 9 ARG A 62 ? ? -106.49 -111.72 91 9 ASP A 64 ? ? -107.40 56.52 92 9 ASP A 88 ? ? -93.34 35.54 93 9 ASP A 90 ? ? 71.46 32.09 94 9 LYS A 95 ? ? -82.92 -80.92 95 10 THR A 25 ? ? -125.79 -52.46 96 10 LYS A 26 ? ? 170.84 -50.65 97 10 VAL A 36 ? ? -156.98 -33.91 98 10 PRO A 38 ? ? -52.73 -84.36 99 10 SER A 39 ? ? -146.71 -74.37 100 10 LYS A 59 ? ? -164.57 68.73 101 10 ASP A 61 ? ? -106.09 49.48 102 10 ARG A 62 ? ? -105.59 -127.89 103 10 ASP A 64 ? ? -109.26 51.24 104 10 ASP A 88 ? ? -67.96 26.01 105 10 LYS A 95 ? ? -78.95 -82.47 106 11 THR A 25 ? ? -125.40 -63.32 107 11 LYS A 26 ? ? -179.74 -51.14 108 11 VAL A 36 ? ? -158.35 -33.56 109 11 PRO A 38 ? ? -54.75 -86.58 110 11 SER A 39 ? ? -144.62 -75.08 111 11 TYR A 56 ? ? -73.27 49.04 112 11 LYS A 59 ? ? -176.14 45.43 113 11 ASP A 61 ? ? -108.53 42.83 114 11 ARG A 62 ? ? -104.55 -114.42 115 11 ASP A 64 ? ? -97.87 53.95 116 11 ASP A 88 ? ? -82.05 31.27 117 11 ASP A 89 ? ? -128.18 -85.89 118 11 ASP A 90 ? ? -174.92 27.89 119 11 LYS A 95 ? ? -82.01 -81.99 120 12 THR A 25 ? ? -125.69 -59.20 121 12 LYS A 26 ? ? -178.47 -50.67 122 12 VAL A 36 ? ? -151.31 -31.01 123 12 PRO A 38 ? ? -56.49 -79.17 124 12 SER A 39 ? ? -151.31 -71.80 125 12 ASP A 64 ? ? -89.36 47.50 126 12 ASP A 88 ? ? -80.04 31.26 127 12 ASP A 89 ? ? -129.18 -89.44 128 12 ASP A 90 ? ? -171.35 28.08 129 13 THR A 25 ? ? -125.52 -56.76 130 13 LYS A 26 ? ? 179.02 -49.08 131 13 PRO A 38 ? ? -56.80 -83.22 132 13 SER A 39 ? ? -146.88 -72.22 133 13 TYR A 56 ? ? -70.42 47.76 134 13 LYS A 59 ? ? -178.77 48.76 135 13 ARG A 62 ? ? -106.20 -115.69 136 13 ASP A 64 ? ? -93.80 55.16 137 13 ASP A 88 ? ? -92.51 32.90 138 13 ASP A 90 ? ? 73.00 30.98 139 13 LYS A 95 ? ? -81.91 -81.57 140 14 THR A 25 ? ? -125.32 -63.37 141 14 LYS A 26 ? ? 179.57 -50.91 142 14 VAL A 36 ? ? -151.07 -37.23 143 14 PRO A 38 ? ? -53.77 -80.87 144 14 SER A 39 ? ? -152.07 -74.44 145 14 TYR A 56 ? ? -71.19 44.89 146 14 LYS A 59 ? ? -163.46 67.95 147 14 ASP A 61 ? ? -104.94 44.05 148 14 ARG A 62 ? ? -102.05 -125.96 149 14 ASP A 64 ? ? -109.46 52.65 150 14 ASP A 88 ? ? -67.03 24.62 151 14 ASP A 89 ? ? -140.48 -159.72 152 15 LYS A 24 ? ? -122.69 -73.40 153 15 VAL A 36 ? ? -156.96 -27.89 154 15 PRO A 38 ? ? -61.14 -178.25 155 15 SER A 39 ? ? -53.40 -75.97 156 15 LYS A 59 ? ? -159.87 48.42 157 15 ARG A 62 ? ? -106.21 -108.25 158 15 ASP A 88 ? ? -93.09 37.92 159 15 LYS A 95 ? ? -79.28 -81.51 160 16 THR A 25 ? ? -126.10 -50.78 161 16 LYS A 26 ? ? 171.38 -51.46 162 16 VAL A 36 ? ? -150.67 -33.24 163 16 PRO A 38 ? ? -60.38 -169.65 164 16 SER A 39 ? ? -60.00 -79.12 165 16 LYS A 59 ? ? -150.38 67.64 166 16 ASP A 61 ? ? -106.81 46.72 167 16 ARG A 62 ? ? -105.94 -129.15 168 16 ASP A 64 ? ? -108.94 50.62 169 16 ASP A 88 ? ? -81.88 30.08 170 16 ASP A 89 ? ? -125.76 -86.91 171 16 ASP A 90 ? ? -173.96 28.77 172 16 LYS A 95 ? ? -80.60 -82.27 173 17 THR A 25 ? ? -125.50 -56.64 174 17 LYS A 26 ? ? 177.20 -51.19 175 17 VAL A 36 ? ? -156.92 -35.48 176 17 PRO A 38 ? ? -61.86 -179.95 177 17 SER A 39 ? ? -54.00 -73.74 178 17 TYR A 56 ? ? -70.50 46.35 179 17 LYS A 59 ? ? -178.74 48.12 180 17 ASP A 61 ? ? -107.30 43.43 181 17 ARG A 62 ? ? -106.29 -117.40 182 17 ASP A 64 ? ? -105.63 56.14 183 17 ASP A 88 ? ? -86.48 34.02 184 17 ASP A 89 ? ? -130.70 -86.81 185 17 ASP A 90 ? ? -173.43 27.83 186 17 LYS A 95 ? ? -79.74 -82.24 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Montreal-Kingston Bacterial Structural Genomics Initiative' _pdbx_SG_project.initial_of_center BSGI # _pdbx_nmr_ensemble.entry_id 1SG7 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 17 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1SG7 _pdbx_nmr_representative.conformer_id 16 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.5mM ChaB U-15N,13C 50mM CaCl2 1mM NaN3' '90% H2O/10% D2O' 2 '1mM ChaB U-15N,50mM Phosphate buffer, 100mM NaCl, 1mM NaN3, 11mg/ml Pf1 phage' '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 303 ambient 6.3 '50mM CaCl2' ? K 2 303 ambient 6.3 '50mM Phosphate, 100mM NaCl' ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '3D 15N/13C edited NOESY' 2 1 1 HNHA 3 1 1 3D_13C-separated_NOESY 4 1 1 4D_13C-separated_NOESY 5 2 2 IPAP-HSQC 6 1 1 4D_13C/15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1SG7 _pdbx_nmr_refine.method ;simulated annealing molecular dynamics ; _pdbx_nmr_refine.details 'The structures were determined from 2150 NOE restraints, 49 dihedral angle constraints and 58 residual dipolar coupling restraints.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.2 processing 'delaglio et al' 1 NMRView 5.0.4 'data analysis' 'Belvins and Johnson' 2 ARIA 1.1 'structure solution' Nilges 3 CNS 1.1 'structure solution' 'Brunger et al' 4 CNS 1.1 refinement 'Brunger et al' 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A HIS 11 ? A HIS 11 12 1 Y 1 A HIS 12 ? A HIS 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A SER 14 ? A SER 14 15 1 Y 1 A GLY 15 ? A GLY 15 16 1 Y 1 A PHE 16 ? A PHE 16 17 1 Y 1 A ASN 17 ? A ASN 17 18 1 Y 1 A PRO 18 ? A PRO 18 19 1 Y 1 A ARG 19 ? A ARG 19 20 1 Y 1 A GLY 20 ? A GLY 20 21 1 Y 1 A SER 21 ? A SER 21 22 2 Y 1 A MET 1 ? A MET 1 23 2 Y 1 A GLY 2 ? A GLY 2 24 2 Y 1 A SER 3 ? A SER 3 25 2 Y 1 A SER 4 ? A SER 4 26 2 Y 1 A HIS 5 ? A HIS 5 27 2 Y 1 A HIS 6 ? A HIS 6 28 2 Y 1 A HIS 7 ? A HIS 7 29 2 Y 1 A HIS 8 ? A HIS 8 30 2 Y 1 A HIS 9 ? A HIS 9 31 2 Y 1 A HIS 10 ? A HIS 10 32 2 Y 1 A HIS 11 ? A HIS 11 33 2 Y 1 A HIS 12 ? A HIS 12 34 2 Y 1 A SER 13 ? A SER 13 35 2 Y 1 A SER 14 ? A SER 14 36 2 Y 1 A GLY 15 ? A GLY 15 37 2 Y 1 A PHE 16 ? A PHE 16 38 2 Y 1 A ASN 17 ? A ASN 17 39 2 Y 1 A PRO 18 ? A PRO 18 40 2 Y 1 A ARG 19 ? A ARG 19 41 2 Y 1 A GLY 20 ? A GLY 20 42 2 Y 1 A SER 21 ? A SER 21 43 3 Y 1 A MET 1 ? A MET 1 44 3 Y 1 A GLY 2 ? A GLY 2 45 3 Y 1 A SER 3 ? A SER 3 46 3 Y 1 A SER 4 ? A SER 4 47 3 Y 1 A HIS 5 ? A HIS 5 48 3 Y 1 A HIS 6 ? A HIS 6 49 3 Y 1 A HIS 7 ? A HIS 7 50 3 Y 1 A HIS 8 ? A HIS 8 51 3 Y 1 A HIS 9 ? A HIS 9 52 3 Y 1 A HIS 10 ? A HIS 10 53 3 Y 1 A HIS 11 ? A HIS 11 54 3 Y 1 A HIS 12 ? A HIS 12 55 3 Y 1 A SER 13 ? A SER 13 56 3 Y 1 A SER 14 ? A SER 14 57 3 Y 1 A GLY 15 ? A GLY 15 58 3 Y 1 A PHE 16 ? A PHE 16 59 3 Y 1 A ASN 17 ? A ASN 17 60 3 Y 1 A PRO 18 ? A PRO 18 61 3 Y 1 A ARG 19 ? A ARG 19 62 3 Y 1 A GLY 20 ? A GLY 20 63 3 Y 1 A SER 21 ? A SER 21 64 4 Y 1 A MET 1 ? A MET 1 65 4 Y 1 A GLY 2 ? A GLY 2 66 4 Y 1 A SER 3 ? A SER 3 67 4 Y 1 A SER 4 ? A SER 4 68 4 Y 1 A HIS 5 ? A HIS 5 69 4 Y 1 A HIS 6 ? A HIS 6 70 4 Y 1 A HIS 7 ? A HIS 7 71 4 Y 1 A HIS 8 ? A HIS 8 72 4 Y 1 A HIS 9 ? A HIS 9 73 4 Y 1 A HIS 10 ? A HIS 10 74 4 Y 1 A HIS 11 ? A HIS 11 75 4 Y 1 A HIS 12 ? A HIS 12 76 4 Y 1 A SER 13 ? A SER 13 77 4 Y 1 A SER 14 ? A SER 14 78 4 Y 1 A GLY 15 ? A GLY 15 79 4 Y 1 A PHE 16 ? A PHE 16 80 4 Y 1 A ASN 17 ? A ASN 17 81 4 Y 1 A PRO 18 ? A PRO 18 82 4 Y 1 A ARG 19 ? A ARG 19 83 4 Y 1 A GLY 20 ? A GLY 20 84 4 Y 1 A SER 21 ? A SER 21 85 5 Y 1 A MET 1 ? A MET 1 86 5 Y 1 A GLY 2 ? A GLY 2 87 5 Y 1 A SER 3 ? A SER 3 88 5 Y 1 A SER 4 ? A SER 4 89 5 Y 1 A HIS 5 ? A HIS 5 90 5 Y 1 A HIS 6 ? A HIS 6 91 5 Y 1 A HIS 7 ? A HIS 7 92 5 Y 1 A HIS 8 ? A HIS 8 93 5 Y 1 A HIS 9 ? A HIS 9 94 5 Y 1 A HIS 10 ? A HIS 10 95 5 Y 1 A HIS 11 ? A HIS 11 96 5 Y 1 A HIS 12 ? A HIS 12 97 5 Y 1 A SER 13 ? A SER 13 98 5 Y 1 A SER 14 ? A SER 14 99 5 Y 1 A GLY 15 ? A GLY 15 100 5 Y 1 A PHE 16 ? A PHE 16 101 5 Y 1 A ASN 17 ? A ASN 17 102 5 Y 1 A PRO 18 ? A PRO 18 103 5 Y 1 A ARG 19 ? A ARG 19 104 5 Y 1 A GLY 20 ? A GLY 20 105 5 Y 1 A SER 21 ? A SER 21 106 6 Y 1 A MET 1 ? A MET 1 107 6 Y 1 A GLY 2 ? A GLY 2 108 6 Y 1 A SER 3 ? A SER 3 109 6 Y 1 A SER 4 ? A SER 4 110 6 Y 1 A HIS 5 ? A HIS 5 111 6 Y 1 A HIS 6 ? A HIS 6 112 6 Y 1 A HIS 7 ? A HIS 7 113 6 Y 1 A HIS 8 ? A HIS 8 114 6 Y 1 A HIS 9 ? A HIS 9 115 6 Y 1 A HIS 10 ? A HIS 10 116 6 Y 1 A HIS 11 ? A HIS 11 117 6 Y 1 A HIS 12 ? A HIS 12 118 6 Y 1 A SER 13 ? A SER 13 119 6 Y 1 A SER 14 ? A SER 14 120 6 Y 1 A GLY 15 ? A GLY 15 121 6 Y 1 A PHE 16 ? A PHE 16 122 6 Y 1 A ASN 17 ? A ASN 17 123 6 Y 1 A PRO 18 ? A PRO 18 124 6 Y 1 A ARG 19 ? A ARG 19 125 6 Y 1 A GLY 20 ? A GLY 20 126 6 Y 1 A SER 21 ? A SER 21 127 7 Y 1 A MET 1 ? A MET 1 128 7 Y 1 A GLY 2 ? A GLY 2 129 7 Y 1 A SER 3 ? A SER 3 130 7 Y 1 A SER 4 ? A SER 4 131 7 Y 1 A HIS 5 ? A HIS 5 132 7 Y 1 A HIS 6 ? A HIS 6 133 7 Y 1 A HIS 7 ? A HIS 7 134 7 Y 1 A HIS 8 ? A HIS 8 135 7 Y 1 A HIS 9 ? A HIS 9 136 7 Y 1 A HIS 10 ? A HIS 10 137 7 Y 1 A HIS 11 ? A HIS 11 138 7 Y 1 A HIS 12 ? A HIS 12 139 7 Y 1 A SER 13 ? A SER 13 140 7 Y 1 A SER 14 ? A SER 14 141 7 Y 1 A GLY 15 ? A GLY 15 142 7 Y 1 A PHE 16 ? A PHE 16 143 7 Y 1 A ASN 17 ? A ASN 17 144 7 Y 1 A PRO 18 ? A PRO 18 145 7 Y 1 A ARG 19 ? A ARG 19 146 7 Y 1 A GLY 20 ? A GLY 20 147 7 Y 1 A SER 21 ? A SER 21 148 8 Y 1 A MET 1 ? A MET 1 149 8 Y 1 A GLY 2 ? A GLY 2 150 8 Y 1 A SER 3 ? A SER 3 151 8 Y 1 A SER 4 ? A SER 4 152 8 Y 1 A HIS 5 ? A HIS 5 153 8 Y 1 A HIS 6 ? A HIS 6 154 8 Y 1 A HIS 7 ? A HIS 7 155 8 Y 1 A HIS 8 ? A HIS 8 156 8 Y 1 A HIS 9 ? A HIS 9 157 8 Y 1 A HIS 10 ? A HIS 10 158 8 Y 1 A HIS 11 ? A HIS 11 159 8 Y 1 A HIS 12 ? A HIS 12 160 8 Y 1 A SER 13 ? A SER 13 161 8 Y 1 A SER 14 ? A SER 14 162 8 Y 1 A GLY 15 ? A GLY 15 163 8 Y 1 A PHE 16 ? A PHE 16 164 8 Y 1 A ASN 17 ? A ASN 17 165 8 Y 1 A PRO 18 ? A PRO 18 166 8 Y 1 A ARG 19 ? A ARG 19 167 8 Y 1 A GLY 20 ? A GLY 20 168 8 Y 1 A SER 21 ? A SER 21 169 9 Y 1 A MET 1 ? A MET 1 170 9 Y 1 A GLY 2 ? A GLY 2 171 9 Y 1 A SER 3 ? A SER 3 172 9 Y 1 A SER 4 ? A SER 4 173 9 Y 1 A HIS 5 ? A HIS 5 174 9 Y 1 A HIS 6 ? A HIS 6 175 9 Y 1 A HIS 7 ? A HIS 7 176 9 Y 1 A HIS 8 ? A HIS 8 177 9 Y 1 A HIS 9 ? A HIS 9 178 9 Y 1 A HIS 10 ? A HIS 10 179 9 Y 1 A HIS 11 ? A HIS 11 180 9 Y 1 A HIS 12 ? A HIS 12 181 9 Y 1 A SER 13 ? A SER 13 182 9 Y 1 A SER 14 ? A SER 14 183 9 Y 1 A GLY 15 ? A GLY 15 184 9 Y 1 A PHE 16 ? A PHE 16 185 9 Y 1 A ASN 17 ? A ASN 17 186 9 Y 1 A PRO 18 ? A PRO 18 187 9 Y 1 A ARG 19 ? A ARG 19 188 9 Y 1 A GLY 20 ? A GLY 20 189 9 Y 1 A SER 21 ? A SER 21 190 10 Y 1 A MET 1 ? A MET 1 191 10 Y 1 A GLY 2 ? A GLY 2 192 10 Y 1 A SER 3 ? A SER 3 193 10 Y 1 A SER 4 ? A SER 4 194 10 Y 1 A HIS 5 ? A HIS 5 195 10 Y 1 A HIS 6 ? A HIS 6 196 10 Y 1 A HIS 7 ? A HIS 7 197 10 Y 1 A HIS 8 ? A HIS 8 198 10 Y 1 A HIS 9 ? A HIS 9 199 10 Y 1 A HIS 10 ? A HIS 10 200 10 Y 1 A HIS 11 ? A HIS 11 201 10 Y 1 A HIS 12 ? A HIS 12 202 10 Y 1 A SER 13 ? A SER 13 203 10 Y 1 A SER 14 ? A SER 14 204 10 Y 1 A GLY 15 ? A GLY 15 205 10 Y 1 A PHE 16 ? A PHE 16 206 10 Y 1 A ASN 17 ? A ASN 17 207 10 Y 1 A PRO 18 ? A PRO 18 208 10 Y 1 A ARG 19 ? A ARG 19 209 10 Y 1 A GLY 20 ? A GLY 20 210 10 Y 1 A SER 21 ? A SER 21 211 11 Y 1 A MET 1 ? A MET 1 212 11 Y 1 A GLY 2 ? A GLY 2 213 11 Y 1 A SER 3 ? A SER 3 214 11 Y 1 A SER 4 ? A SER 4 215 11 Y 1 A HIS 5 ? A HIS 5 216 11 Y 1 A HIS 6 ? A HIS 6 217 11 Y 1 A HIS 7 ? A HIS 7 218 11 Y 1 A HIS 8 ? A HIS 8 219 11 Y 1 A HIS 9 ? A HIS 9 220 11 Y 1 A HIS 10 ? A HIS 10 221 11 Y 1 A HIS 11 ? A HIS 11 222 11 Y 1 A HIS 12 ? A HIS 12 223 11 Y 1 A SER 13 ? A SER 13 224 11 Y 1 A SER 14 ? A SER 14 225 11 Y 1 A GLY 15 ? A GLY 15 226 11 Y 1 A PHE 16 ? A PHE 16 227 11 Y 1 A ASN 17 ? A ASN 17 228 11 Y 1 A PRO 18 ? A PRO 18 229 11 Y 1 A ARG 19 ? A ARG 19 230 11 Y 1 A GLY 20 ? A GLY 20 231 11 Y 1 A SER 21 ? A SER 21 232 12 Y 1 A MET 1 ? A MET 1 233 12 Y 1 A GLY 2 ? A GLY 2 234 12 Y 1 A SER 3 ? A SER 3 235 12 Y 1 A SER 4 ? A SER 4 236 12 Y 1 A HIS 5 ? A HIS 5 237 12 Y 1 A HIS 6 ? A HIS 6 238 12 Y 1 A HIS 7 ? A HIS 7 239 12 Y 1 A HIS 8 ? A HIS 8 240 12 Y 1 A HIS 9 ? A HIS 9 241 12 Y 1 A HIS 10 ? A HIS 10 242 12 Y 1 A HIS 11 ? A HIS 11 243 12 Y 1 A HIS 12 ? A HIS 12 244 12 Y 1 A SER 13 ? A SER 13 245 12 Y 1 A SER 14 ? A SER 14 246 12 Y 1 A GLY 15 ? A GLY 15 247 12 Y 1 A PHE 16 ? A PHE 16 248 12 Y 1 A ASN 17 ? A ASN 17 249 12 Y 1 A PRO 18 ? A PRO 18 250 12 Y 1 A ARG 19 ? A ARG 19 251 12 Y 1 A GLY 20 ? A GLY 20 252 12 Y 1 A SER 21 ? A SER 21 253 13 Y 1 A MET 1 ? A MET 1 254 13 Y 1 A GLY 2 ? A GLY 2 255 13 Y 1 A SER 3 ? A SER 3 256 13 Y 1 A SER 4 ? A SER 4 257 13 Y 1 A HIS 5 ? A HIS 5 258 13 Y 1 A HIS 6 ? A HIS 6 259 13 Y 1 A HIS 7 ? A HIS 7 260 13 Y 1 A HIS 8 ? A HIS 8 261 13 Y 1 A HIS 9 ? A HIS 9 262 13 Y 1 A HIS 10 ? A HIS 10 263 13 Y 1 A HIS 11 ? A HIS 11 264 13 Y 1 A HIS 12 ? A HIS 12 265 13 Y 1 A SER 13 ? A SER 13 266 13 Y 1 A SER 14 ? A SER 14 267 13 Y 1 A GLY 15 ? A GLY 15 268 13 Y 1 A PHE 16 ? A PHE 16 269 13 Y 1 A ASN 17 ? A ASN 17 270 13 Y 1 A PRO 18 ? A PRO 18 271 13 Y 1 A ARG 19 ? A ARG 19 272 13 Y 1 A GLY 20 ? A GLY 20 273 13 Y 1 A SER 21 ? A SER 21 274 14 Y 1 A MET 1 ? A MET 1 275 14 Y 1 A GLY 2 ? A GLY 2 276 14 Y 1 A SER 3 ? A SER 3 277 14 Y 1 A SER 4 ? A SER 4 278 14 Y 1 A HIS 5 ? A HIS 5 279 14 Y 1 A HIS 6 ? A HIS 6 280 14 Y 1 A HIS 7 ? A HIS 7 281 14 Y 1 A HIS 8 ? A HIS 8 282 14 Y 1 A HIS 9 ? A HIS 9 283 14 Y 1 A HIS 10 ? A HIS 10 284 14 Y 1 A HIS 11 ? A HIS 11 285 14 Y 1 A HIS 12 ? A HIS 12 286 14 Y 1 A SER 13 ? A SER 13 287 14 Y 1 A SER 14 ? A SER 14 288 14 Y 1 A GLY 15 ? A GLY 15 289 14 Y 1 A PHE 16 ? A PHE 16 290 14 Y 1 A ASN 17 ? A ASN 17 291 14 Y 1 A PRO 18 ? A PRO 18 292 14 Y 1 A ARG 19 ? A ARG 19 293 14 Y 1 A GLY 20 ? A GLY 20 294 14 Y 1 A SER 21 ? A SER 21 295 15 Y 1 A MET 1 ? A MET 1 296 15 Y 1 A GLY 2 ? A GLY 2 297 15 Y 1 A SER 3 ? A SER 3 298 15 Y 1 A SER 4 ? A SER 4 299 15 Y 1 A HIS 5 ? A HIS 5 300 15 Y 1 A HIS 6 ? A HIS 6 301 15 Y 1 A HIS 7 ? A HIS 7 302 15 Y 1 A HIS 8 ? A HIS 8 303 15 Y 1 A HIS 9 ? A HIS 9 304 15 Y 1 A HIS 10 ? A HIS 10 305 15 Y 1 A HIS 11 ? A HIS 11 306 15 Y 1 A HIS 12 ? A HIS 12 307 15 Y 1 A SER 13 ? A SER 13 308 15 Y 1 A SER 14 ? A SER 14 309 15 Y 1 A GLY 15 ? A GLY 15 310 15 Y 1 A PHE 16 ? A PHE 16 311 15 Y 1 A ASN 17 ? A ASN 17 312 15 Y 1 A PRO 18 ? A PRO 18 313 15 Y 1 A ARG 19 ? A ARG 19 314 15 Y 1 A GLY 20 ? A GLY 20 315 15 Y 1 A SER 21 ? A SER 21 316 16 Y 1 A MET 1 ? A MET 1 317 16 Y 1 A GLY 2 ? A GLY 2 318 16 Y 1 A SER 3 ? A SER 3 319 16 Y 1 A SER 4 ? A SER 4 320 16 Y 1 A HIS 5 ? A HIS 5 321 16 Y 1 A HIS 6 ? A HIS 6 322 16 Y 1 A HIS 7 ? A HIS 7 323 16 Y 1 A HIS 8 ? A HIS 8 324 16 Y 1 A HIS 9 ? A HIS 9 325 16 Y 1 A HIS 10 ? A HIS 10 326 16 Y 1 A HIS 11 ? A HIS 11 327 16 Y 1 A HIS 12 ? A HIS 12 328 16 Y 1 A SER 13 ? A SER 13 329 16 Y 1 A SER 14 ? A SER 14 330 16 Y 1 A GLY 15 ? A GLY 15 331 16 Y 1 A PHE 16 ? A PHE 16 332 16 Y 1 A ASN 17 ? A ASN 17 333 16 Y 1 A PRO 18 ? A PRO 18 334 16 Y 1 A ARG 19 ? A ARG 19 335 16 Y 1 A GLY 20 ? A GLY 20 336 16 Y 1 A SER 21 ? A SER 21 337 17 Y 1 A MET 1 ? A MET 1 338 17 Y 1 A GLY 2 ? A GLY 2 339 17 Y 1 A SER 3 ? A SER 3 340 17 Y 1 A SER 4 ? A SER 4 341 17 Y 1 A HIS 5 ? A HIS 5 342 17 Y 1 A HIS 6 ? A HIS 6 343 17 Y 1 A HIS 7 ? A HIS 7 344 17 Y 1 A HIS 8 ? A HIS 8 345 17 Y 1 A HIS 9 ? A HIS 9 346 17 Y 1 A HIS 10 ? A HIS 10 347 17 Y 1 A HIS 11 ? A HIS 11 348 17 Y 1 A HIS 12 ? A HIS 12 349 17 Y 1 A SER 13 ? A SER 13 350 17 Y 1 A SER 14 ? A SER 14 351 17 Y 1 A GLY 15 ? A GLY 15 352 17 Y 1 A PHE 16 ? A PHE 16 353 17 Y 1 A ASN 17 ? A ASN 17 354 17 Y 1 A PRO 18 ? A PRO 18 355 17 Y 1 A ARG 19 ? A ARG 19 356 17 Y 1 A GLY 20 ? A GLY 20 357 17 Y 1 A SER 21 ? A SER 21 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 600 2 ? Varian UNITYPLUS 800 # _atom_sites.entry_id 1SG7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ #