data_1SH4 # _entry.id 1SH4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SH4 pdb_00001sh4 10.2210/pdb1sh4/pdb RCSB RCSB021703 ? ? WWPDB D_1000021703 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-10 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_ref_seq_dif.details' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _database_PDB_caveat.id 1 _database_PDB_caveat.text 'Chirality error at the CA center of ALA A 3' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SH4 _pdbx_database_status.recvd_initial_deposition_date 2004-02-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1nx7 _pdbx_database_related.details 'Solution Structures of the Oxidized Bovine Microsomal Cytochrome b5' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, H.' 1 'Zhang, Q.' 2 # _citation.id primary _citation.title 'The comparative study on the solution structures of the oxidized bovine microsomal cytochrome b5 and mutant V45H' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 13 _citation.page_first 2161 _citation.page_last 2169 _citation.year 2004 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15273310 _citation.pdbx_database_id_DOI 10.1110/ps.04721104 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, Q.' 1 ? primary 'Cao, C.' 2 ? primary 'Wang, Z.Q.' 3 ? primary 'Wang, Y.H.' 4 ? primary 'Wu, H.' 5 ? primary 'Huang, Z.X.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome b5' 9514.396 1 ? V45H 'residues 3-84' ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEHLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPD DR ; _entity_poly.pdbx_seq_one_letter_code_can ;AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEHLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPD DR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'PROTOPORPHYRIN IX CONTAINING FE' _pdbx_entity_nonpoly.comp_id HEM # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 VAL n 1 3 LYS n 1 4 TYR n 1 5 TYR n 1 6 THR n 1 7 LEU n 1 8 GLU n 1 9 GLU n 1 10 ILE n 1 11 GLN n 1 12 LYS n 1 13 HIS n 1 14 ASN n 1 15 ASN n 1 16 SER n 1 17 LYS n 1 18 SER n 1 19 THR n 1 20 TRP n 1 21 LEU n 1 22 ILE n 1 23 LEU n 1 24 HIS n 1 25 TYR n 1 26 LYS n 1 27 VAL n 1 28 TYR n 1 29 ASP n 1 30 LEU n 1 31 THR n 1 32 LYS n 1 33 PHE n 1 34 LEU n 1 35 GLU n 1 36 GLU n 1 37 HIS n 1 38 PRO n 1 39 GLY n 1 40 GLY n 1 41 GLU n 1 42 GLU n 1 43 HIS n 1 44 LEU n 1 45 ARG n 1 46 GLU n 1 47 GLN n 1 48 ALA n 1 49 GLY n 1 50 GLY n 1 51 ASP n 1 52 ALA n 1 53 THR n 1 54 GLU n 1 55 ASN n 1 56 PHE n 1 57 GLU n 1 58 ASP n 1 59 VAL n 1 60 GLY n 1 61 HIS n 1 62 SER n 1 63 THR n 1 64 ASP n 1 65 ALA n 1 66 ARG n 1 67 GLU n 1 68 LEU n 1 69 SER n 1 70 LYS n 1 71 THR n 1 72 PHE n 1 73 ILE n 1 74 ILE n 1 75 GLY n 1 76 GLU n 1 77 LEU n 1 78 HIS n 1 79 PRO n 1 80 ASP n 1 81 ASP n 1 82 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 3 3 ALA ALA A . n A 1 2 VAL 2 4 4 VAL VAL A . n A 1 3 LYS 3 5 5 LYS LYS A . n A 1 4 TYR 4 6 6 TYR TYR A . n A 1 5 TYR 5 7 7 TYR TYR A . n A 1 6 THR 6 8 8 THR THR A . n A 1 7 LEU 7 9 9 LEU LEU A . n A 1 8 GLU 8 10 10 GLU GLU A . n A 1 9 GLU 9 11 11 GLU GLU A . n A 1 10 ILE 10 12 12 ILE ILE A . n A 1 11 GLN 11 13 13 GLN GLN A . n A 1 12 LYS 12 14 14 LYS LYS A . n A 1 13 HIS 13 15 15 HIS HIS A . n A 1 14 ASN 14 16 16 ASN ASN A . n A 1 15 ASN 15 17 17 ASN ASN A . n A 1 16 SER 16 18 18 SER SER A . n A 1 17 LYS 17 19 19 LYS LYS A . n A 1 18 SER 18 20 20 SER SER A . n A 1 19 THR 19 21 21 THR THR A . n A 1 20 TRP 20 22 22 TRP TRP A . n A 1 21 LEU 21 23 23 LEU LEU A . n A 1 22 ILE 22 24 24 ILE ILE A . n A 1 23 LEU 23 25 25 LEU LEU A . n A 1 24 HIS 24 26 26 HIS HIS A . n A 1 25 TYR 25 27 27 TYR TYR A . n A 1 26 LYS 26 28 28 LYS LYS A . n A 1 27 VAL 27 29 29 VAL VAL A . n A 1 28 TYR 28 30 30 TYR TYR A . n A 1 29 ASP 29 31 31 ASP ASP A . n A 1 30 LEU 30 32 32 LEU LEU A . n A 1 31 THR 31 33 33 THR THR A . n A 1 32 LYS 32 34 34 LYS LYS A . n A 1 33 PHE 33 35 35 PHE PHE A . n A 1 34 LEU 34 36 36 LEU LEU A . n A 1 35 GLU 35 37 37 GLU GLU A . n A 1 36 GLU 36 38 38 GLU GLU A . n A 1 37 HIS 37 39 39 HIS HIS A . n A 1 38 PRO 38 40 40 PRO PRO A . n A 1 39 GLY 39 41 41 GLY GLY A . n A 1 40 GLY 40 42 42 GLY GLY A . n A 1 41 GLU 41 43 43 GLU GLU A . n A 1 42 GLU 42 44 44 GLU GLU A . n A 1 43 HIS 43 45 45 HIS HIS A . n A 1 44 LEU 44 46 46 LEU LEU A . n A 1 45 ARG 45 47 47 ARG ARG A . n A 1 46 GLU 46 48 48 GLU GLU A . n A 1 47 GLN 47 49 49 GLN GLN A . n A 1 48 ALA 48 50 50 ALA ALA A . n A 1 49 GLY 49 51 51 GLY GLY A . n A 1 50 GLY 50 52 52 GLY GLY A . n A 1 51 ASP 51 53 53 ASP ASP A . n A 1 52 ALA 52 54 54 ALA ALA A . n A 1 53 THR 53 55 55 THR THR A . n A 1 54 GLU 54 56 56 GLU GLU A . n A 1 55 ASN 55 57 57 ASN ASN A . n A 1 56 PHE 56 58 58 PHE PHE A . n A 1 57 GLU 57 59 59 GLU GLU A . n A 1 58 ASP 58 60 60 ASP ASP A . n A 1 59 VAL 59 61 61 VAL VAL A . n A 1 60 GLY 60 62 62 GLY GLY A . n A 1 61 HIS 61 63 63 HIS HIS A . n A 1 62 SER 62 64 64 SER SER A . n A 1 63 THR 63 65 65 THR THR A . n A 1 64 ASP 64 66 66 ASP ASP A . n A 1 65 ALA 65 67 67 ALA ALA A . n A 1 66 ARG 66 68 68 ARG ARG A . n A 1 67 GLU 67 69 69 GLU GLU A . n A 1 68 LEU 68 70 70 LEU LEU A . n A 1 69 SER 69 71 71 SER SER A . n A 1 70 LYS 70 72 72 LYS LYS A . n A 1 71 THR 71 73 73 THR THR A . n A 1 72 PHE 72 74 74 PHE PHE A . n A 1 73 ILE 73 75 75 ILE ILE A . n A 1 74 ILE 74 76 76 ILE ILE A . n A 1 75 GLY 75 77 77 GLY GLY A . n A 1 76 GLU 76 78 78 GLU GLU A . n A 1 77 LEU 77 79 79 LEU LEU A . n A 1 78 HIS 78 80 80 HIS HIS A . n A 1 79 PRO 79 81 81 PRO PRO A . n A 1 80 ASP 80 82 82 ASP ASP A . n A 1 81 ASP 81 83 83 ASP ASP A . n A 1 82 ARG 82 84 84 ARG ARG A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEM _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id HEM _pdbx_nonpoly_scheme.auth_mon_id HEM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 63 ? C ? A HIS 61 C 2 1 Y 1 A HIS 63 ? O ? A HIS 61 O 3 2 Y 1 A HIS 63 ? C ? A HIS 61 C 4 2 Y 1 A HIS 63 ? O ? A HIS 61 O 5 3 Y 1 A HIS 63 ? C ? A HIS 61 C 6 3 Y 1 A HIS 63 ? O ? A HIS 61 O 7 4 Y 1 A HIS 63 ? C ? A HIS 61 C 8 4 Y 1 A HIS 63 ? O ? A HIS 61 O 9 5 Y 1 A HIS 63 ? C ? A HIS 61 C 10 5 Y 1 A HIS 63 ? O ? A HIS 61 O 11 6 Y 1 A HIS 63 ? C ? A HIS 61 C 12 6 Y 1 A HIS 63 ? O ? A HIS 61 O 13 7 Y 1 A HIS 63 ? C ? A HIS 61 C 14 7 Y 1 A HIS 63 ? O ? A HIS 61 O 15 8 Y 1 A HIS 63 ? C ? A HIS 61 C 16 8 Y 1 A HIS 63 ? O ? A HIS 61 O 17 9 Y 1 A HIS 63 ? C ? A HIS 61 C 18 9 Y 1 A HIS 63 ? O ? A HIS 61 O 19 10 Y 1 A HIS 63 ? C ? A HIS 61 C 20 10 Y 1 A HIS 63 ? O ? A HIS 61 O 21 11 Y 1 A HIS 63 ? C ? A HIS 61 C 22 11 Y 1 A HIS 63 ? O ? A HIS 61 O 23 12 Y 1 A HIS 63 ? C ? A HIS 61 C 24 12 Y 1 A HIS 63 ? O ? A HIS 61 O 25 13 Y 1 A HIS 63 ? C ? A HIS 61 C 26 13 Y 1 A HIS 63 ? O ? A HIS 61 O 27 14 Y 1 A HIS 63 ? C ? A HIS 61 C 28 14 Y 1 A HIS 63 ? O ? A HIS 61 O 29 15 Y 1 A HIS 63 ? C ? A HIS 61 C 30 15 Y 1 A HIS 63 ? O ? A HIS 61 O 31 16 Y 1 A HIS 63 ? C ? A HIS 61 C 32 16 Y 1 A HIS 63 ? O ? A HIS 61 O 33 17 Y 1 A HIS 63 ? C ? A HIS 61 C 34 17 Y 1 A HIS 63 ? O ? A HIS 61 O 35 18 Y 1 A HIS 63 ? C ? A HIS 61 C 36 18 Y 1 A HIS 63 ? O ? A HIS 61 O 37 19 Y 1 A HIS 63 ? C ? A HIS 61 C 38 19 Y 1 A HIS 63 ? O ? A HIS 61 O 39 20 Y 1 A HIS 63 ? C ? A HIS 61 C 40 20 Y 1 A HIS 63 ? O ? A HIS 61 O 41 21 Y 1 A HIS 63 ? C ? A HIS 61 C 42 21 Y 1 A HIS 63 ? O ? A HIS 61 O 43 22 Y 1 A HIS 63 ? C ? A HIS 61 C 44 22 Y 1 A HIS 63 ? O ? A HIS 61 O 45 23 Y 1 A HIS 63 ? C ? A HIS 61 C 46 23 Y 1 A HIS 63 ? O ? A HIS 61 O 47 24 Y 1 A HIS 63 ? C ? A HIS 61 C 48 24 Y 1 A HIS 63 ? O ? A HIS 61 O 49 25 Y 1 A HIS 63 ? C ? A HIS 61 C 50 25 Y 1 A HIS 63 ? O ? A HIS 61 O 51 26 Y 1 A HIS 63 ? C ? A HIS 61 C 52 26 Y 1 A HIS 63 ? O ? A HIS 61 O 53 27 Y 1 A HIS 63 ? C ? A HIS 61 C 54 27 Y 1 A HIS 63 ? O ? A HIS 61 O 55 28 Y 1 A HIS 63 ? C ? A HIS 61 C 56 28 Y 1 A HIS 63 ? O ? A HIS 61 O 57 29 Y 1 A HIS 63 ? C ? A HIS 61 C 58 29 Y 1 A HIS 63 ? O ? A HIS 61 O 59 30 Y 1 A HIS 63 ? C ? A HIS 61 C 60 30 Y 1 A HIS 63 ? O ? A HIS 61 O # _exptl.entry_id 1SH4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1SH4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1SH4 _struct.title 'Solution structure of oxidized bovine microsomal cytochrome B5 Mutant V45H' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SH4 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'FIVE HELIX, FIVE SHEET, HEME RING, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYB5_BOVIN _struct_ref.pdbx_db_accession P00171 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPD DR ; _struct_ref.pdbx_align_begin 7 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SH4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00171 _struct_ref_seq.db_align_beg 7 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 88 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 84 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1SH4 _struct_ref_seq_dif.mon_id HIS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 43 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00171 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 49 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 45 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? HIS A 13 ? THR A 8 HIS A 15 1 ? 8 HELX_P HELX_P2 2 LYS A 32 ? HIS A 37 ? LYS A 34 HIS A 39 1 ? 6 HELX_P HELX_P3 3 GLY A 39 ? ALA A 48 ? GLY A 41 ALA A 50 1 ? 10 HELX_P HELX_P4 4 ALA A 52 ? GLY A 60 ? ALA A 54 GLY A 62 1 ? 9 HELX_P HELX_P5 5 SER A 62 ? THR A 71 ? SER A 64 THR A 73 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 37 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 39 A HEM 201 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc2 metalc ? ? A HIS 61 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 63 A HEM 201 1_555 ? ? ? ? ? ? ? 1.978 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 37 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NA ? B HEM . ? A HEM 201 ? 1_555 95.2 ? 2 NE2 ? A HIS 37 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NB ? B HEM . ? A HEM 201 ? 1_555 93.0 ? 3 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NB ? B HEM . ? A HEM 201 ? 1_555 89.1 ? 4 NE2 ? A HIS 37 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 87.7 ? 5 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 177.1 ? 6 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 90.9 ? 7 NE2 ? A HIS 37 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 88.8 ? 8 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 89.6 ? 9 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 177.8 ? 10 NC ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 90.4 ? 11 NE2 ? A HIS 37 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NE2 ? A HIS 61 ? A HIS 63 ? 1_555 174.2 ? 12 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NE2 ? A HIS 61 ? A HIS 63 ? 1_555 90.4 ? 13 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NE2 ? A HIS 61 ? A HIS 63 ? 1_555 88.8 ? 14 NC ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NE2 ? A HIS 61 ? A HIS 63 ? 1_555 86.8 ? 15 ND ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NE2 ? A HIS 61 ? A HIS 63 ? 1_555 89.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 14 ? ASN A 15 ? ASN A 16 ASN A 17 A 2 SER A 18 ? LEU A 23 ? SER A 20 LEU A 25 A 3 LYS A 26 ? ASP A 29 ? LYS A 28 ASP A 31 A 4 ILE A 73 ? GLU A 76 ? ILE A 75 GLU A 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASN A 15 ? N ASN A 17 O SER A 18 ? O SER A 20 A 2 3 N LEU A 21 ? N LEU A 23 O TYR A 28 ? O TYR A 30 A 3 4 N VAL A 27 ? N VAL A 29 O ILE A 74 ? O ILE A 76 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEM _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'BINDING SITE FOR RESIDUE HEM A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 LEU A 23 ? LEU A 25 . ? 1_555 ? 2 AC1 15 TYR A 28 ? TYR A 30 . ? 1_555 ? 3 AC1 15 PHE A 33 ? PHE A 35 . ? 1_555 ? 4 AC1 15 HIS A 37 ? HIS A 39 . ? 1_555 ? 5 AC1 15 HIS A 43 ? HIS A 45 . ? 1_555 ? 6 AC1 15 LEU A 44 ? LEU A 46 . ? 1_555 ? 7 AC1 15 GLN A 47 ? GLN A 49 . ? 1_555 ? 8 AC1 15 ASN A 55 ? ASN A 57 . ? 1_555 ? 9 AC1 15 PHE A 56 ? PHE A 58 . ? 1_555 ? 10 AC1 15 VAL A 59 ? VAL A 61 . ? 1_555 ? 11 AC1 15 HIS A 61 ? HIS A 63 . ? 1_555 ? 12 AC1 15 SER A 62 ? SER A 64 . ? 1_555 ? 13 AC1 15 ALA A 65 ? ALA A 67 . ? 1_555 ? 14 AC1 15 LEU A 68 ? LEU A 70 . ? 1_555 ? 15 AC1 15 PHE A 72 ? PHE A 74 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.37 120.80 -4.43 0.70 N 2 2 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.37 120.80 -4.43 0.70 N 3 3 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 133.51 115.30 18.21 2.30 N 4 3 NE A ARG 68 ? ? CZ A ARG 68 ? ? NH1 A ARG 68 ? ? 124.64 120.30 4.34 0.50 N 5 4 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 130.75 115.30 15.45 2.30 N 6 5 N A ASP 83 ? ? CA A ASP 83 ? ? CB A ASP 83 ? ? 98.23 110.60 -12.37 1.80 N 7 5 NE A ARG 84 ? ? CZ A ARG 84 ? ? NH1 A ARG 84 ? ? 123.51 120.30 3.21 0.50 N 8 6 N A ASP 83 ? ? CA A ASP 83 ? ? CB A ASP 83 ? ? 98.23 110.60 -12.37 1.80 N 9 6 NE A ARG 84 ? ? CZ A ARG 84 ? ? NH1 A ARG 84 ? ? 123.51 120.30 3.21 0.50 N 10 7 N A ASP 83 ? ? CA A ASP 83 ? ? CB A ASP 83 ? ? 97.19 110.60 -13.41 1.80 N 11 10 NE A ARG 47 ? ? CZ A ARG 47 ? ? NH1 A ARG 47 ? ? 124.29 120.30 3.99 0.50 N 12 10 N A ASP 83 ? ? CA A ASP 83 ? ? CB A ASP 83 ? ? 96.32 110.60 -14.28 1.80 N 13 10 NE A ARG 84 ? ? CZ A ARG 84 ? ? NH1 A ARG 84 ? ? 123.94 120.30 3.64 0.50 N 14 11 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 131.12 115.30 15.82 2.30 N 15 11 NE A ARG 84 ? ? CZ A ARG 84 ? ? NH1 A ARG 84 ? ? 123.69 120.30 3.39 0.50 N 16 12 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 130.86 115.30 15.56 2.30 N 17 12 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.55 120.80 -4.25 0.70 N 18 12 NE A ARG 84 ? ? CZ A ARG 84 ? ? NH1 A ARG 84 ? ? 123.57 120.30 3.27 0.50 N 19 13 N A ASP 83 ? ? CA A ASP 83 ? ? CB A ASP 83 ? ? 95.88 110.60 -14.72 1.80 N 20 15 N A ASP 83 ? ? CA A ASP 83 ? ? CB A ASP 83 ? ? 99.46 110.60 -11.14 1.80 N 21 16 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 131.06 115.30 15.76 2.30 N 22 16 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.24 120.80 -4.56 0.70 N 23 16 NE A ARG 84 ? ? CZ A ARG 84 ? ? NH1 A ARG 84 ? ? 123.35 120.30 3.05 0.50 N 24 17 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 129.62 115.30 14.32 2.30 N 25 17 NE A ARG 68 ? ? CZ A ARG 68 ? ? NH1 A ARG 68 ? ? 124.51 120.30 4.21 0.50 N 26 18 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.44 120.80 -4.36 0.70 N 27 19 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 129.76 115.30 14.46 2.30 N 28 19 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.58 120.80 -4.22 0.70 N 29 20 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 130.50 115.30 15.20 2.30 N 30 20 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 117.15 121.00 -3.85 0.60 N 31 21 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 130.50 115.30 15.20 2.30 N 32 21 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 117.15 121.00 -3.85 0.60 N 33 22 NE A ARG 47 ? ? CZ A ARG 47 ? ? NH1 A ARG 47 ? ? 123.55 120.30 3.25 0.50 N 34 22 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.47 120.80 -4.33 0.70 N 35 23 N A ASP 83 ? ? CA A ASP 83 ? ? CB A ASP 83 ? ? 95.00 110.60 -15.60 1.80 N 36 24 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 130.85 115.30 15.55 2.30 N 37 24 NE A ARG 68 ? ? CZ A ARG 68 ? ? NH1 A ARG 68 ? ? 123.49 120.30 3.19 0.50 N 38 25 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 130.38 115.30 15.08 2.30 N 39 26 CA A LEU 23 ? ? CB A LEU 23 ? ? CG A LEU 23 ? ? 130.38 115.30 15.08 2.30 N 40 27 N A ASP 83 ? ? CA A ASP 83 ? ? CB A ASP 83 ? ? 96.35 110.60 -14.25 1.80 N 41 28 N A ASP 83 ? ? CA A ASP 83 ? ? CB A ASP 83 ? ? 96.77 110.60 -13.83 1.80 N 42 29 NE A ARG 68 ? ? CZ A ARG 68 ? ? NH1 A ARG 68 ? ? 123.41 120.30 3.11 0.50 N 43 30 NE A ARG 68 ? ? CZ A ARG 68 ? ? NH1 A ARG 68 ? ? 123.41 120.30 3.11 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 6 ? ? 63.73 157.00 2 1 ASN A 16 ? ? -154.41 24.68 3 1 SER A 20 ? ? 167.05 158.19 4 1 TYR A 27 ? ? 70.80 -22.38 5 1 ALA A 50 ? ? -48.06 151.14 6 1 ASP A 53 ? ? -2.75 99.98 7 1 HIS A 80 ? ? 68.51 143.94 8 1 ASP A 82 ? ? -93.22 30.41 9 1 ASP A 83 ? ? -143.61 -47.76 10 2 TYR A 6 ? ? 63.73 157.00 11 2 ASN A 16 ? ? -154.41 24.68 12 2 SER A 20 ? ? 167.05 158.19 13 2 TYR A 27 ? ? 70.80 -22.38 14 2 ALA A 50 ? ? -48.06 151.14 15 2 ASP A 53 ? ? -2.75 99.98 16 2 HIS A 80 ? ? 68.51 143.94 17 2 ASP A 82 ? ? -93.22 30.41 18 2 ASP A 83 ? ? -143.61 -47.76 19 3 ASN A 16 ? ? -151.20 42.57 20 3 SER A 20 ? ? 176.77 133.93 21 3 HIS A 26 ? ? 72.29 53.25 22 3 TYR A 27 ? ? 65.62 -18.55 23 3 LEU A 32 ? ? -117.88 -88.59 24 3 THR A 33 ? ? 72.81 -45.60 25 3 ALA A 50 ? ? -47.37 151.28 26 3 ASP A 53 ? ? -13.82 102.21 27 3 HIS A 80 ? ? 72.82 140.02 28 3 ASP A 82 ? ? -94.26 34.68 29 3 ASP A 83 ? ? -146.83 -49.59 30 4 TYR A 6 ? ? 66.77 151.15 31 4 ASN A 16 ? ? -160.96 52.01 32 4 ASN A 17 ? ? -140.65 -130.70 33 4 HIS A 26 ? ? 70.78 59.04 34 4 TYR A 27 ? ? 68.23 -25.94 35 4 THR A 33 ? ? -39.32 -28.65 36 4 LEU A 36 ? ? -28.88 -57.47 37 4 ASP A 53 ? ? 5.63 106.47 38 4 ASP A 66 ? ? -29.91 -55.07 39 4 HIS A 80 ? ? 71.39 145.46 40 4 ASP A 83 ? ? -141.07 -48.10 41 5 TYR A 6 ? ? 65.08 156.14 42 5 ASN A 16 ? ? -153.17 22.37 43 5 HIS A 26 ? ? 67.13 61.64 44 5 TYR A 27 ? ? 68.29 -31.16 45 5 THR A 33 ? ? 42.79 -52.14 46 5 ASP A 53 ? ? 64.18 111.76 47 5 ALA A 54 ? ? -143.12 26.78 48 5 ASP A 60 ? ? -52.44 -85.83 49 5 ASP A 66 ? ? -26.32 -54.31 50 5 LEU A 79 ? ? -68.35 11.63 51 5 HIS A 80 ? ? 76.48 149.66 52 5 ASP A 82 ? ? -101.83 41.52 53 5 ASP A 83 ? ? -151.86 -53.27 54 6 TYR A 6 ? ? 65.08 156.14 55 6 ASN A 16 ? ? -153.17 22.37 56 6 HIS A 26 ? ? 67.13 61.64 57 6 TYR A 27 ? ? 68.29 -31.16 58 6 THR A 33 ? ? 42.79 -52.14 59 6 ASP A 53 ? ? 64.18 111.76 60 6 ALA A 54 ? ? -143.12 26.78 61 6 ASP A 60 ? ? -52.44 -85.83 62 6 ASP A 66 ? ? -26.32 -54.31 63 6 LEU A 79 ? ? -68.35 11.63 64 6 HIS A 80 ? ? 76.48 149.66 65 6 ASP A 82 ? ? -101.83 41.52 66 6 ASP A 83 ? ? -151.86 -53.27 67 7 TYR A 6 ? ? 65.19 148.21 68 7 HIS A 15 ? ? -100.43 78.97 69 7 ASN A 16 ? ? -154.93 46.44 70 7 SER A 20 ? ? 171.92 156.84 71 7 TYR A 27 ? ? 66.13 -21.73 72 7 THR A 33 ? ? -43.93 -19.16 73 7 LEU A 36 ? ? -26.22 -56.48 74 7 ASP A 53 ? ? -0.88 99.72 75 7 HIS A 80 ? ? 72.67 160.96 76 7 ASP A 83 ? ? -149.82 -66.58 77 8 TYR A 6 ? ? 62.56 135.67 78 8 ASN A 16 ? ? -168.00 46.45 79 8 ASN A 17 ? ? -148.41 -131.02 80 8 LYS A 19 ? ? -25.89 -58.82 81 8 TYR A 27 ? ? 67.60 -26.84 82 8 LEU A 36 ? ? -28.31 -55.91 83 8 ALA A 50 ? ? -48.18 152.97 84 8 ASP A 53 ? ? 58.59 103.84 85 8 VAL A 61 ? ? -95.55 46.17 86 8 HIS A 80 ? ? 74.19 144.69 87 8 ASP A 82 ? ? -91.42 31.74 88 8 ASP A 83 ? ? -150.99 -57.91 89 9 TYR A 6 ? ? 68.03 144.01 90 9 HIS A 15 ? ? -112.41 77.72 91 9 ASN A 16 ? ? -159.25 52.61 92 9 TYR A 27 ? ? 64.97 -24.74 93 9 LEU A 36 ? ? -26.19 -58.85 94 9 ASP A 53 ? ? -0.08 98.56 95 9 HIS A 80 ? ? 74.77 146.28 96 9 ASP A 82 ? ? -97.12 34.75 97 9 ASP A 83 ? ? -155.09 -60.37 98 10 TYR A 6 ? ? 63.87 151.43 99 10 ASN A 16 ? ? -154.23 37.40 100 10 LYS A 19 ? ? -29.50 -55.70 101 10 SER A 20 ? ? 161.67 144.04 102 10 TYR A 27 ? ? 63.51 -18.19 103 10 THR A 33 ? ? -53.58 -4.97 104 10 PRO A 40 ? ? -68.54 -152.13 105 10 ALA A 50 ? ? -49.42 151.84 106 10 ASP A 53 ? ? 0.11 99.21 107 10 HIS A 80 ? ? 69.34 159.35 108 10 ASP A 82 ? ? -99.55 37.37 109 10 ASP A 83 ? ? -147.43 -53.37 110 11 TYR A 6 ? ? 62.80 150.32 111 11 ASN A 16 ? ? -153.73 40.09 112 11 SER A 20 ? ? 178.63 139.49 113 11 TYR A 27 ? ? 65.81 -26.86 114 11 ALA A 50 ? ? -49.34 152.61 115 11 ASP A 53 ? ? -9.29 101.01 116 11 HIS A 80 ? ? 77.39 146.59 117 11 ASP A 82 ? ? -98.04 33.46 118 11 ASP A 83 ? ? -153.92 -59.60 119 12 TYR A 6 ? ? 67.00 141.16 120 12 ASN A 16 ? ? -165.95 42.11 121 12 ASN A 17 ? ? -163.02 -137.66 122 12 LYS A 19 ? ? -155.81 -60.59 123 12 TYR A 27 ? ? 69.79 -14.01 124 12 LEU A 36 ? ? -28.70 -55.53 125 12 ASP A 53 ? ? 94.97 121.48 126 12 ALA A 54 ? ? -146.09 25.00 127 12 HIS A 80 ? ? 75.18 141.80 128 12 ASP A 83 ? ? -149.60 -50.84 129 13 TYR A 6 ? ? 81.25 150.47 130 13 ASN A 16 ? ? -152.73 30.72 131 13 LYS A 19 ? ? -28.97 -53.35 132 13 SER A 20 ? ? 166.86 145.11 133 13 HIS A 26 ? ? 69.78 61.66 134 13 TYR A 27 ? ? 66.86 -29.87 135 13 GLU A 43 ? ? 139.28 -49.68 136 13 ASP A 53 ? ? 69.52 111.49 137 13 ALA A 54 ? ? -141.74 26.68 138 13 VAL A 61 ? ? -86.45 49.06 139 13 HIS A 80 ? ? 70.17 158.13 140 13 ASP A 82 ? ? -96.58 30.29 141 13 ASP A 83 ? ? -145.31 -49.43 142 14 TYR A 6 ? ? 67.06 149.94 143 14 SER A 20 ? ? 144.23 139.49 144 14 TYR A 27 ? ? 68.68 -25.59 145 14 LEU A 36 ? ? -27.70 -50.54 146 14 ASP A 53 ? ? 66.85 123.27 147 14 ALA A 54 ? ? -154.18 29.40 148 14 HIS A 80 ? ? 73.36 142.97 149 14 ASP A 83 ? ? -138.17 -47.21 150 15 TYR A 6 ? ? 62.54 134.05 151 15 ASN A 16 ? ? -159.55 65.23 152 15 ASN A 17 ? ? -146.77 -145.86 153 15 LYS A 19 ? ? -29.32 -64.63 154 15 TYR A 27 ? ? 70.15 -20.51 155 15 THR A 33 ? ? 39.98 -53.53 156 15 LEU A 36 ? ? -28.37 -51.37 157 15 ALA A 50 ? ? -44.28 157.73 158 15 ASP A 53 ? ? 41.56 88.37 159 15 ALA A 54 ? ? -153.07 16.76 160 15 HIS A 80 ? ? 65.26 154.18 161 15 ASP A 83 ? ? -148.58 -7.59 162 16 TYR A 6 ? ? 62.97 153.12 163 16 ASN A 16 ? ? -161.18 38.75 164 16 ASN A 17 ? ? -160.01 -137.22 165 16 LYS A 19 ? ? -146.64 -72.27 166 16 TYR A 27 ? ? 66.64 -26.66 167 16 ALA A 50 ? ? -46.58 153.07 168 16 ASP A 53 ? ? 4.33 100.94 169 16 HIS A 80 ? ? 79.93 146.34 170 16 ASP A 82 ? ? -98.81 34.37 171 16 ASP A 83 ? ? -153.49 -60.15 172 17 TYR A 6 ? ? 63.81 157.00 173 17 HIS A 15 ? ? -118.48 76.15 174 17 SER A 20 ? ? 174.63 131.11 175 17 TYR A 27 ? ? 66.15 -22.03 176 17 ALA A 50 ? ? -48.81 151.18 177 17 ASP A 53 ? ? -13.85 104.41 178 17 HIS A 80 ? ? 74.54 146.77 179 17 ASP A 82 ? ? -91.07 34.21 180 17 ASP A 83 ? ? -153.81 -58.15 181 18 TYR A 6 ? ? 61.01 154.76 182 18 ASN A 16 ? ? -147.67 -9.90 183 18 LYS A 19 ? ? -154.43 -68.14 184 18 TYR A 27 ? ? 65.72 -15.84 185 18 ALA A 50 ? ? -48.33 151.20 186 18 ASP A 53 ? ? -8.05 99.73 187 18 HIS A 80 ? ? 69.46 152.34 188 18 ASP A 82 ? ? -91.93 35.53 189 18 ASP A 83 ? ? -152.04 -54.35 190 19 ASN A 16 ? ? -156.79 46.91 191 19 ASN A 17 ? ? -143.63 -141.09 192 19 TYR A 27 ? ? 66.94 -17.78 193 19 THR A 33 ? ? -37.22 -31.23 194 19 ASP A 53 ? ? -0.50 102.50 195 19 HIS A 80 ? ? 69.85 153.12 196 19 ASP A 82 ? ? -93.18 42.28 197 19 ASP A 83 ? ? -154.35 -56.65 198 20 TYR A 6 ? ? 96.03 154.55 199 20 ASN A 16 ? ? -144.96 17.51 200 20 SER A 20 ? ? 159.46 130.82 201 20 TYR A 27 ? ? 70.23 -19.98 202 20 LEU A 32 ? ? -106.66 -80.58 203 20 THR A 33 ? ? 70.96 -46.35 204 20 ALA A 50 ? ? -49.29 150.05 205 20 ASP A 53 ? ? 67.84 110.04 206 20 ALA A 54 ? ? -141.54 25.43 207 20 VAL A 61 ? ? -93.67 47.95 208 20 ASP A 66 ? ? -29.70 -56.22 209 20 HIS A 80 ? ? 68.05 146.54 210 20 ASP A 82 ? ? -93.67 31.42 211 20 ASP A 83 ? ? -141.25 -47.80 212 21 TYR A 6 ? ? 96.03 154.55 213 21 ASN A 16 ? ? -144.96 17.51 214 21 SER A 20 ? ? 159.46 130.82 215 21 TYR A 27 ? ? 70.23 -19.98 216 21 LEU A 32 ? ? -106.66 -80.58 217 21 THR A 33 ? ? 70.96 -46.35 218 21 ALA A 50 ? ? -49.29 150.05 219 21 ASP A 53 ? ? 67.84 110.04 220 21 ALA A 54 ? ? -141.54 25.43 221 21 VAL A 61 ? ? -93.67 47.95 222 21 ASP A 66 ? ? -29.70 -56.22 223 21 HIS A 80 ? ? 68.05 146.54 224 21 ASP A 82 ? ? -93.67 31.42 225 21 ASP A 83 ? ? -141.25 -47.80 226 22 TYR A 6 ? ? 82.81 132.22 227 22 ASN A 16 ? ? -161.83 41.59 228 22 ASN A 17 ? ? -145.00 -122.29 229 22 LYS A 19 ? ? -23.71 -57.13 230 22 TYR A 27 ? ? 69.05 -9.28 231 22 THR A 33 ? ? 36.71 -48.93 232 22 LEU A 36 ? ? -29.19 -54.48 233 22 ASP A 53 ? ? 7.48 98.78 234 22 HIS A 80 ? ? 85.49 127.95 235 22 ASP A 83 ? ? -135.91 -43.29 236 23 VAL A 4 ? ? 56.73 160.91 237 23 TYR A 6 ? ? 69.65 143.79 238 23 ASN A 16 ? ? -140.34 17.92 239 23 LYS A 19 ? ? -29.28 -44.41 240 23 SER A 20 ? ? 153.06 128.12 241 23 TYR A 27 ? ? 69.06 -22.07 242 23 ASP A 53 ? ? -6.10 107.35 243 23 ALA A 54 ? ? -141.81 24.97 244 23 HIS A 80 ? ? 66.27 149.80 245 23 ASP A 82 ? ? -91.73 35.50 246 23 ASP A 83 ? ? -150.42 -17.47 247 24 VAL A 4 ? ? 67.49 170.28 248 24 TYR A 6 ? ? 64.90 147.42 249 24 ASN A 16 ? ? -157.38 30.17 250 24 ASN A 17 ? ? -91.71 -120.00 251 24 HIS A 26 ? ? 71.32 56.73 252 24 TYR A 27 ? ? 67.76 -26.63 253 24 THR A 33 ? ? 38.08 -52.69 254 24 LEU A 36 ? ? -27.15 -59.32 255 24 ASP A 53 ? ? -14.74 100.43 256 24 HIS A 80 ? ? 85.13 144.18 257 24 ASP A 82 ? ? -99.15 33.57 258 24 ASP A 83 ? ? -153.27 -57.80 259 25 TYR A 6 ? ? 66.31 144.59 260 25 ASN A 16 ? ? -141.30 29.05 261 25 SER A 20 ? ? 172.70 125.81 262 25 HIS A 26 ? ? 70.06 56.13 263 25 TYR A 27 ? ? 67.49 -26.49 264 25 THR A 33 ? ? 42.36 -51.88 265 25 ASP A 53 ? ? 70.76 108.42 266 25 HIS A 80 ? ? 74.47 140.92 267 25 ASP A 83 ? ? -134.35 -47.65 268 26 TYR A 6 ? ? 66.31 144.59 269 26 ASN A 16 ? ? -141.30 29.05 270 26 SER A 20 ? ? 172.70 125.81 271 26 HIS A 26 ? ? 70.06 56.13 272 26 TYR A 27 ? ? 67.49 -26.49 273 26 THR A 33 ? ? 42.36 -51.88 274 26 ASP A 53 ? ? 70.76 108.42 275 26 HIS A 80 ? ? 74.47 140.92 276 26 ASP A 83 ? ? -134.35 -47.65 277 27 TYR A 6 ? ? 69.25 147.33 278 27 ASN A 16 ? ? -144.92 23.50 279 27 ASN A 17 ? ? -160.07 -158.20 280 27 LYS A 19 ? ? -24.89 -59.13 281 27 SER A 20 ? ? 161.59 152.57 282 27 TYR A 27 ? ? 70.02 -21.98 283 27 THR A 33 ? ? 44.51 -58.75 284 27 ALA A 50 ? ? -46.68 154.43 285 27 ASP A 53 ? ? 67.87 115.62 286 27 ALA A 54 ? ? -150.09 28.58 287 27 VAL A 61 ? ? -102.80 48.23 288 27 HIS A 80 ? ? 77.26 157.25 289 27 ASP A 82 ? ? -97.03 31.48 290 27 ASP A 83 ? ? -147.35 -51.07 291 28 HIS A 15 ? ? -101.22 64.38 292 28 ASN A 16 ? ? -158.88 76.91 293 28 ASN A 17 ? ? -150.78 25.12 294 28 SER A 18 ? ? 80.43 -47.30 295 28 LYS A 19 ? ? -23.68 -54.23 296 28 TYR A 27 ? ? 69.62 -24.38 297 28 THR A 33 ? ? 43.01 -52.25 298 28 LEU A 36 ? ? -28.58 -54.32 299 28 ALA A 50 ? ? -48.23 161.59 300 28 ASP A 53 ? ? 3.89 100.34 301 28 HIS A 80 ? ? 75.48 155.48 302 28 ASP A 82 ? ? -97.10 32.61 303 28 ASP A 83 ? ? -151.67 -66.56 304 29 TYR A 6 ? ? 62.84 152.56 305 29 ASN A 16 ? ? -160.47 39.54 306 29 ASN A 17 ? ? -162.81 -159.74 307 29 SER A 20 ? ? 159.52 167.92 308 29 TYR A 27 ? ? 66.84 -16.62 309 29 THR A 33 ? ? 38.92 -52.77 310 29 PRO A 40 ? ? -67.51 -170.43 311 29 ASP A 53 ? ? -7.27 105.66 312 29 HIS A 80 ? ? 84.03 134.09 313 29 ASP A 83 ? ? -142.03 -41.78 314 30 TYR A 6 ? ? 62.84 152.56 315 30 ASN A 16 ? ? -160.47 39.54 316 30 ASN A 17 ? ? -162.81 -159.74 317 30 SER A 20 ? ? 159.52 167.92 318 30 TYR A 27 ? ? 66.84 -16.62 319 30 THR A 33 ? ? 38.92 -52.77 320 30 PRO A 40 ? ? -67.51 -170.43 321 30 ASP A 53 ? ? -7.27 105.66 322 30 HIS A 80 ? ? 84.03 134.09 323 30 ASP A 83 ? ? -142.03 -41.78 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 4 CA ? A ALA 3 ? 'WRONG HAND' . 2 7 CA ? A ALA 3 ? 'WRONG HAND' . 3 14 CA ? A ALA 3 ? 'WRONG HAND' . 4 18 CA ? A ALA 3 ? 'WRONG HAND' . 5 24 CA ? A ALA 3 ? 'WRONG HAND' . 6 25 CA ? A ALA 3 ? 'WRONG HAND' . 7 26 CA ? A ALA 3 ? 'WRONG HAND' . 8 28 CA ? A ALA 3 ? 'WRONG HAND' . # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 6 ? ? 0.086 'SIDE CHAIN' 2 1 TYR A 27 ? ? 0.069 'SIDE CHAIN' 3 1 ARG A 68 ? ? 0.107 'SIDE CHAIN' 4 2 TYR A 6 ? ? 0.086 'SIDE CHAIN' 5 2 TYR A 27 ? ? 0.069 'SIDE CHAIN' 6 2 ARG A 68 ? ? 0.107 'SIDE CHAIN' 7 3 TYR A 7 ? ? 0.117 'SIDE CHAIN' 8 3 TYR A 27 ? ? 0.088 'SIDE CHAIN' 9 4 TYR A 27 ? ? 0.069 'SIDE CHAIN' 10 4 PHE A 58 ? ? 0.090 'SIDE CHAIN' 11 7 TYR A 27 ? ? 0.063 'SIDE CHAIN' 12 7 ARG A 47 ? ? 0.086 'SIDE CHAIN' 13 7 PHE A 58 ? ? 0.074 'SIDE CHAIN' 14 7 ARG A 68 ? ? 0.145 'SIDE CHAIN' 15 8 PHE A 58 ? ? 0.104 'SIDE CHAIN' 16 9 ARG A 47 ? ? 0.086 'SIDE CHAIN' 17 9 ARG A 68 ? ? 0.098 'SIDE CHAIN' 18 10 TYR A 27 ? ? 0.173 'SIDE CHAIN' 19 10 PHE A 35 ? ? 0.099 'SIDE CHAIN' 20 10 HIS A 63 ? ? 0.086 'SIDE CHAIN' 21 11 TYR A 7 ? ? 0.083 'SIDE CHAIN' 22 11 PHE A 58 ? ? 0.091 'SIDE CHAIN' 23 11 ARG A 68 ? ? 0.121 'SIDE CHAIN' 24 12 ARG A 47 ? ? 0.095 'SIDE CHAIN' 25 13 TYR A 6 ? ? 0.174 'SIDE CHAIN' 26 13 TYR A 7 ? ? 0.071 'SIDE CHAIN' 27 13 TYR A 27 ? ? 0.072 'SIDE CHAIN' 28 14 TYR A 27 ? ? 0.073 'SIDE CHAIN' 29 14 PHE A 58 ? ? 0.078 'SIDE CHAIN' 30 14 ARG A 68 ? ? 0.094 'SIDE CHAIN' 31 15 TYR A 27 ? ? 0.100 'SIDE CHAIN' 32 15 TYR A 30 ? ? 0.068 'SIDE CHAIN' 33 15 ARG A 84 ? ? 0.084 'SIDE CHAIN' 34 16 TYR A 7 ? ? 0.081 'SIDE CHAIN' 35 17 TYR A 7 ? ? 0.065 'SIDE CHAIN' 36 18 TYR A 27 ? ? 0.194 'SIDE CHAIN' 37 19 ARG A 68 ? ? 0.107 'SIDE CHAIN' 38 19 ARG A 84 ? ? 0.104 'SIDE CHAIN' 39 20 TYR A 27 ? ? 0.071 'SIDE CHAIN' 40 20 ARG A 47 ? ? 0.095 'SIDE CHAIN' 41 21 TYR A 27 ? ? 0.071 'SIDE CHAIN' 42 21 ARG A 47 ? ? 0.095 'SIDE CHAIN' 43 22 TYR A 6 ? ? 0.166 'SIDE CHAIN' 44 22 TYR A 27 ? ? 0.099 'SIDE CHAIN' 45 22 ARG A 68 ? ? 0.159 'SIDE CHAIN' 46 23 TYR A 6 ? ? 0.124 'SIDE CHAIN' 47 23 ARG A 68 ? ? 0.112 'SIDE CHAIN' 48 24 TYR A 6 ? ? 0.163 'SIDE CHAIN' 49 24 PHE A 58 ? ? 0.083 'SIDE CHAIN' 50 25 TYR A 7 ? ? 0.092 'SIDE CHAIN' 51 25 TYR A 27 ? ? 0.084 'SIDE CHAIN' 52 25 PHE A 58 ? ? 0.094 'SIDE CHAIN' 53 25 ARG A 68 ? ? 0.108 'SIDE CHAIN' 54 26 TYR A 7 ? ? 0.092 'SIDE CHAIN' 55 26 TYR A 27 ? ? 0.084 'SIDE CHAIN' 56 26 PHE A 58 ? ? 0.094 'SIDE CHAIN' 57 26 ARG A 68 ? ? 0.108 'SIDE CHAIN' 58 27 TYR A 7 ? ? 0.079 'SIDE CHAIN' 59 27 TYR A 27 ? ? 0.069 'SIDE CHAIN' 60 27 TYR A 30 ? ? 0.080 'SIDE CHAIN' 61 27 PHE A 58 ? ? 0.124 'SIDE CHAIN' 62 27 ARG A 68 ? ? 0.168 'SIDE CHAIN' 63 28 TYR A 6 ? ? 0.156 'SIDE CHAIN' 64 28 TYR A 7 ? ? 0.084 'SIDE CHAIN' 65 29 TYR A 27 ? ? 0.098 'SIDE CHAIN' 66 29 PHE A 58 ? ? 0.089 'SIDE CHAIN' 67 29 ARG A 68 ? ? 0.076 'SIDE CHAIN' 68 30 TYR A 27 ? ? 0.098 'SIDE CHAIN' 69 30 PHE A 58 ? ? 0.089 'SIDE CHAIN' 70 30 ARG A 68 ? ? 0.076 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1SH4 _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1SH4 _pdbx_nmr_representative.conformer_id 30 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 3.0mM '90% H2O/10% D2O' 2 3.0mM '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.00 _pdbx_nmr_exptl_sample_conditions.ionic_strength '25mM PHOSPHATE BUFFER' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 DQF-COSY 4 2 1 '2D NOESY' 5 2 1 '2D TOCSY' 6 2 1 DQF-COSY # _pdbx_nmr_refine.entry_id 1SH4 _pdbx_nmr_refine.method 'distance geomitry' _pdbx_nmr_refine.details ;A total of 1682 NOE distance constraints, 24 Stereo-specific assignments constraints and 209 pseudocontact shift constraints were used in structure calculation ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' 'Peter Guntert' 1 VNMR 6.1B collection 'Mike Carlisle' 2 XEASY ? 'data analysis' 'Tai-he Xia and Chrisrian Bartel' 3 Amber 6.0 refinement 'Peter Kollman' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HEM CHA C N N 123 HEM CHB C N N 124 HEM CHC C N N 125 HEM CHD C N N 126 HEM C1A C Y N 127 HEM C2A C Y N 128 HEM C3A C Y N 129 HEM C4A C Y N 130 HEM CMA C N N 131 HEM CAA C N N 132 HEM CBA C N N 133 HEM CGA C N N 134 HEM O1A O N N 135 HEM O2A O N N 136 HEM C1B C N N 137 HEM C2B C N N 138 HEM C3B C N N 139 HEM C4B C N N 140 HEM CMB C N N 141 HEM CAB C N N 142 HEM CBB C N N 143 HEM C1C C Y N 144 HEM C2C C Y N 145 HEM C3C C Y N 146 HEM C4C C Y N 147 HEM CMC C N N 148 HEM CAC C N N 149 HEM CBC C N N 150 HEM C1D C N N 151 HEM C2D C N N 152 HEM C3D C N N 153 HEM C4D C N N 154 HEM CMD C N N 155 HEM CAD C N N 156 HEM CBD C N N 157 HEM CGD C N N 158 HEM O1D O N N 159 HEM O2D O N N 160 HEM NA N Y N 161 HEM NB N N N 162 HEM NC N Y N 163 HEM ND N N N 164 HEM FE FE N N 165 HEM HHB H N N 166 HEM HHC H N N 167 HEM HHD H N N 168 HEM HMA H N N 169 HEM HMAA H N N 170 HEM HMAB H N N 171 HEM HAA H N N 172 HEM HAAA H N N 173 HEM HBA H N N 174 HEM HBAA H N N 175 HEM HMB H N N 176 HEM HMBA H N N 177 HEM HMBB H N N 178 HEM HAB H N N 179 HEM HBB H N N 180 HEM HBBA H N N 181 HEM HMC H N N 182 HEM HMCA H N N 183 HEM HMCB H N N 184 HEM HAC H N N 185 HEM HBC H N N 186 HEM HBCA H N N 187 HEM HMD H N N 188 HEM HMDA H N N 189 HEM HMDB H N N 190 HEM HAD H N N 191 HEM HADA H N N 192 HEM HBD H N N 193 HEM HBDA H N N 194 HEM H2A H N N 195 HEM H2D H N N 196 HEM HHA H N N 197 HIS N N N N 198 HIS CA C N S 199 HIS C C N N 200 HIS O O N N 201 HIS CB C N N 202 HIS CG C Y N 203 HIS ND1 N Y N 204 HIS CD2 C Y N 205 HIS CE1 C Y N 206 HIS NE2 N Y N 207 HIS OXT O N N 208 HIS H H N N 209 HIS H2 H N N 210 HIS HA H N N 211 HIS HB2 H N N 212 HIS HB3 H N N 213 HIS HD1 H N N 214 HIS HD2 H N N 215 HIS HE1 H N N 216 HIS HE2 H N N 217 HIS HXT H N N 218 ILE N N N N 219 ILE CA C N S 220 ILE C C N N 221 ILE O O N N 222 ILE CB C N S 223 ILE CG1 C N N 224 ILE CG2 C N N 225 ILE CD1 C N N 226 ILE OXT O N N 227 ILE H H N N 228 ILE H2 H N N 229 ILE HA H N N 230 ILE HB H N N 231 ILE HG12 H N N 232 ILE HG13 H N N 233 ILE HG21 H N N 234 ILE HG22 H N N 235 ILE HG23 H N N 236 ILE HD11 H N N 237 ILE HD12 H N N 238 ILE HD13 H N N 239 ILE HXT H N N 240 LEU N N N N 241 LEU CA C N S 242 LEU C C N N 243 LEU O O N N 244 LEU CB C N N 245 LEU CG C N N 246 LEU CD1 C N N 247 LEU CD2 C N N 248 LEU OXT O N N 249 LEU H H N N 250 LEU H2 H N N 251 LEU HA H N N 252 LEU HB2 H N N 253 LEU HB3 H N N 254 LEU HG H N N 255 LEU HD11 H N N 256 LEU HD12 H N N 257 LEU HD13 H N N 258 LEU HD21 H N N 259 LEU HD22 H N N 260 LEU HD23 H N N 261 LEU HXT H N N 262 LYS N N N N 263 LYS CA C N S 264 LYS C C N N 265 LYS O O N N 266 LYS CB C N N 267 LYS CG C N N 268 LYS CD C N N 269 LYS CE C N N 270 LYS NZ N N N 271 LYS OXT O N N 272 LYS H H N N 273 LYS H2 H N N 274 LYS HA H N N 275 LYS HB2 H N N 276 LYS HB3 H N N 277 LYS HG2 H N N 278 LYS HG3 H N N 279 LYS HD2 H N N 280 LYS HD3 H N N 281 LYS HE2 H N N 282 LYS HE3 H N N 283 LYS HZ1 H N N 284 LYS HZ2 H N N 285 LYS HZ3 H N N 286 LYS HXT H N N 287 PHE N N N N 288 PHE CA C N S 289 PHE C C N N 290 PHE O O N N 291 PHE CB C N N 292 PHE CG C Y N 293 PHE CD1 C Y N 294 PHE CD2 C Y N 295 PHE CE1 C Y N 296 PHE CE2 C Y N 297 PHE CZ C Y N 298 PHE OXT O N N 299 PHE H H N N 300 PHE H2 H N N 301 PHE HA H N N 302 PHE HB2 H N N 303 PHE HB3 H N N 304 PHE HD1 H N N 305 PHE HD2 H N N 306 PHE HE1 H N N 307 PHE HE2 H N N 308 PHE HZ H N N 309 PHE HXT H N N 310 PRO N N N N 311 PRO CA C N S 312 PRO C C N N 313 PRO O O N N 314 PRO CB C N N 315 PRO CG C N N 316 PRO CD C N N 317 PRO OXT O N N 318 PRO H H N N 319 PRO HA H N N 320 PRO HB2 H N N 321 PRO HB3 H N N 322 PRO HG2 H N N 323 PRO HG3 H N N 324 PRO HD2 H N N 325 PRO HD3 H N N 326 PRO HXT H N N 327 SER N N N N 328 SER CA C N S 329 SER C C N N 330 SER O O N N 331 SER CB C N N 332 SER OG O N N 333 SER OXT O N N 334 SER H H N N 335 SER H2 H N N 336 SER HA H N N 337 SER HB2 H N N 338 SER HB3 H N N 339 SER HG H N N 340 SER HXT H N N 341 THR N N N N 342 THR CA C N S 343 THR C C N N 344 THR O O N N 345 THR CB C N R 346 THR OG1 O N N 347 THR CG2 C N N 348 THR OXT O N N 349 THR H H N N 350 THR H2 H N N 351 THR HA H N N 352 THR HB H N N 353 THR HG1 H N N 354 THR HG21 H N N 355 THR HG22 H N N 356 THR HG23 H N N 357 THR HXT H N N 358 TRP N N N N 359 TRP CA C N S 360 TRP C C N N 361 TRP O O N N 362 TRP CB C N N 363 TRP CG C Y N 364 TRP CD1 C Y N 365 TRP CD2 C Y N 366 TRP NE1 N Y N 367 TRP CE2 C Y N 368 TRP CE3 C Y N 369 TRP CZ2 C Y N 370 TRP CZ3 C Y N 371 TRP CH2 C Y N 372 TRP OXT O N N 373 TRP H H N N 374 TRP H2 H N N 375 TRP HA H N N 376 TRP HB2 H N N 377 TRP HB3 H N N 378 TRP HD1 H N N 379 TRP HE1 H N N 380 TRP HE3 H N N 381 TRP HZ2 H N N 382 TRP HZ3 H N N 383 TRP HH2 H N N 384 TRP HXT H N N 385 TYR N N N N 386 TYR CA C N S 387 TYR C C N N 388 TYR O O N N 389 TYR CB C N N 390 TYR CG C Y N 391 TYR CD1 C Y N 392 TYR CD2 C Y N 393 TYR CE1 C Y N 394 TYR CE2 C Y N 395 TYR CZ C Y N 396 TYR OH O N N 397 TYR OXT O N N 398 TYR H H N N 399 TYR H2 H N N 400 TYR HA H N N 401 TYR HB2 H N N 402 TYR HB3 H N N 403 TYR HD1 H N N 404 TYR HD2 H N N 405 TYR HE1 H N N 406 TYR HE2 H N N 407 TYR HH H N N 408 TYR HXT H N N 409 VAL N N N N 410 VAL CA C N S 411 VAL C C N N 412 VAL O O N N 413 VAL CB C N N 414 VAL CG1 C N N 415 VAL CG2 C N N 416 VAL OXT O N N 417 VAL H H N N 418 VAL H2 H N N 419 VAL HA H N N 420 VAL HB H N N 421 VAL HG11 H N N 422 VAL HG12 H N N 423 VAL HG13 H N N 424 VAL HG21 H N N 425 VAL HG22 H N N 426 VAL HG23 H N N 427 VAL HXT H N N 428 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HEM CHA C1A sing N N 116 HEM CHA C4D doub N N 117 HEM CHA HHA sing N N 118 HEM CHB C4A sing N N 119 HEM CHB C1B doub N N 120 HEM CHB HHB sing N N 121 HEM CHC C4B sing N N 122 HEM CHC C1C doub N N 123 HEM CHC HHC sing N N 124 HEM CHD C4C doub N N 125 HEM CHD C1D sing N N 126 HEM CHD HHD sing N N 127 HEM C1A C2A doub Y N 128 HEM C1A NA sing Y N 129 HEM C2A C3A sing Y N 130 HEM C2A CAA sing N N 131 HEM C3A C4A doub Y N 132 HEM C3A CMA sing N N 133 HEM C4A NA sing Y N 134 HEM CMA HMA sing N N 135 HEM CMA HMAA sing N N 136 HEM CMA HMAB sing N N 137 HEM CAA CBA sing N N 138 HEM CAA HAA sing N N 139 HEM CAA HAAA sing N N 140 HEM CBA CGA sing N N 141 HEM CBA HBA sing N N 142 HEM CBA HBAA sing N N 143 HEM CGA O1A doub N N 144 HEM CGA O2A sing N N 145 HEM C1B C2B sing N N 146 HEM C1B NB sing N N 147 HEM C2B C3B doub N N 148 HEM C2B CMB sing N N 149 HEM C3B C4B sing N N 150 HEM C3B CAB sing N N 151 HEM C4B NB doub N N 152 HEM CMB HMB sing N N 153 HEM CMB HMBA sing N N 154 HEM CMB HMBB sing N N 155 HEM CAB CBB doub N N 156 HEM CAB HAB sing N N 157 HEM CBB HBB sing N N 158 HEM CBB HBBA sing N N 159 HEM C1C C2C sing Y N 160 HEM C1C NC sing Y N 161 HEM C2C C3C doub Y N 162 HEM C2C CMC sing N N 163 HEM C3C C4C sing Y N 164 HEM C3C CAC sing N N 165 HEM C4C NC sing Y N 166 HEM CMC HMC sing N N 167 HEM CMC HMCA sing N N 168 HEM CMC HMCB sing N N 169 HEM CAC CBC doub N N 170 HEM CAC HAC sing N N 171 HEM CBC HBC sing N N 172 HEM CBC HBCA sing N N 173 HEM C1D C2D sing N N 174 HEM C1D ND doub N N 175 HEM C2D C3D doub N N 176 HEM C2D CMD sing N N 177 HEM C3D C4D sing N N 178 HEM C3D CAD sing N N 179 HEM C4D ND sing N N 180 HEM CMD HMD sing N N 181 HEM CMD HMDA sing N N 182 HEM CMD HMDB sing N N 183 HEM CAD CBD sing N N 184 HEM CAD HAD sing N N 185 HEM CAD HADA sing N N 186 HEM CBD CGD sing N N 187 HEM CBD HBD sing N N 188 HEM CBD HBDA sing N N 189 HEM CGD O1D doub N N 190 HEM CGD O2D sing N N 191 HEM O2A H2A sing N N 192 HEM O2D H2D sing N N 193 HEM FE NA sing N N 194 HEM FE NB sing N N 195 HEM FE NC sing N N 196 HEM FE ND sing N N 197 HIS N CA sing N N 198 HIS N H sing N N 199 HIS N H2 sing N N 200 HIS CA C sing N N 201 HIS CA CB sing N N 202 HIS CA HA sing N N 203 HIS C O doub N N 204 HIS C OXT sing N N 205 HIS CB CG sing N N 206 HIS CB HB2 sing N N 207 HIS CB HB3 sing N N 208 HIS CG ND1 sing Y N 209 HIS CG CD2 doub Y N 210 HIS ND1 CE1 doub Y N 211 HIS ND1 HD1 sing N N 212 HIS CD2 NE2 sing Y N 213 HIS CD2 HD2 sing N N 214 HIS CE1 NE2 sing Y N 215 HIS CE1 HE1 sing N N 216 HIS NE2 HE2 sing N N 217 HIS OXT HXT sing N N 218 ILE N CA sing N N 219 ILE N H sing N N 220 ILE N H2 sing N N 221 ILE CA C sing N N 222 ILE CA CB sing N N 223 ILE CA HA sing N N 224 ILE C O doub N N 225 ILE C OXT sing N N 226 ILE CB CG1 sing N N 227 ILE CB CG2 sing N N 228 ILE CB HB sing N N 229 ILE CG1 CD1 sing N N 230 ILE CG1 HG12 sing N N 231 ILE CG1 HG13 sing N N 232 ILE CG2 HG21 sing N N 233 ILE CG2 HG22 sing N N 234 ILE CG2 HG23 sing N N 235 ILE CD1 HD11 sing N N 236 ILE CD1 HD12 sing N N 237 ILE CD1 HD13 sing N N 238 ILE OXT HXT sing N N 239 LEU N CA sing N N 240 LEU N H sing N N 241 LEU N H2 sing N N 242 LEU CA C sing N N 243 LEU CA CB sing N N 244 LEU CA HA sing N N 245 LEU C O doub N N 246 LEU C OXT sing N N 247 LEU CB CG sing N N 248 LEU CB HB2 sing N N 249 LEU CB HB3 sing N N 250 LEU CG CD1 sing N N 251 LEU CG CD2 sing N N 252 LEU CG HG sing N N 253 LEU CD1 HD11 sing N N 254 LEU CD1 HD12 sing N N 255 LEU CD1 HD13 sing N N 256 LEU CD2 HD21 sing N N 257 LEU CD2 HD22 sing N N 258 LEU CD2 HD23 sing N N 259 LEU OXT HXT sing N N 260 LYS N CA sing N N 261 LYS N H sing N N 262 LYS N H2 sing N N 263 LYS CA C sing N N 264 LYS CA CB sing N N 265 LYS CA HA sing N N 266 LYS C O doub N N 267 LYS C OXT sing N N 268 LYS CB CG sing N N 269 LYS CB HB2 sing N N 270 LYS CB HB3 sing N N 271 LYS CG CD sing N N 272 LYS CG HG2 sing N N 273 LYS CG HG3 sing N N 274 LYS CD CE sing N N 275 LYS CD HD2 sing N N 276 LYS CD HD3 sing N N 277 LYS CE NZ sing N N 278 LYS CE HE2 sing N N 279 LYS CE HE3 sing N N 280 LYS NZ HZ1 sing N N 281 LYS NZ HZ2 sing N N 282 LYS NZ HZ3 sing N N 283 LYS OXT HXT sing N N 284 PHE N CA sing N N 285 PHE N H sing N N 286 PHE N H2 sing N N 287 PHE CA C sing N N 288 PHE CA CB sing N N 289 PHE CA HA sing N N 290 PHE C O doub N N 291 PHE C OXT sing N N 292 PHE CB CG sing N N 293 PHE CB HB2 sing N N 294 PHE CB HB3 sing N N 295 PHE CG CD1 doub Y N 296 PHE CG CD2 sing Y N 297 PHE CD1 CE1 sing Y N 298 PHE CD1 HD1 sing N N 299 PHE CD2 CE2 doub Y N 300 PHE CD2 HD2 sing N N 301 PHE CE1 CZ doub Y N 302 PHE CE1 HE1 sing N N 303 PHE CE2 CZ sing Y N 304 PHE CE2 HE2 sing N N 305 PHE CZ HZ sing N N 306 PHE OXT HXT sing N N 307 PRO N CA sing N N 308 PRO N CD sing N N 309 PRO N H sing N N 310 PRO CA C sing N N 311 PRO CA CB sing N N 312 PRO CA HA sing N N 313 PRO C O doub N N 314 PRO C OXT sing N N 315 PRO CB CG sing N N 316 PRO CB HB2 sing N N 317 PRO CB HB3 sing N N 318 PRO CG CD sing N N 319 PRO CG HG2 sing N N 320 PRO CG HG3 sing N N 321 PRO CD HD2 sing N N 322 PRO CD HD3 sing N N 323 PRO OXT HXT sing N N 324 SER N CA sing N N 325 SER N H sing N N 326 SER N H2 sing N N 327 SER CA C sing N N 328 SER CA CB sing N N 329 SER CA HA sing N N 330 SER C O doub N N 331 SER C OXT sing N N 332 SER CB OG sing N N 333 SER CB HB2 sing N N 334 SER CB HB3 sing N N 335 SER OG HG sing N N 336 SER OXT HXT sing N N 337 THR N CA sing N N 338 THR N H sing N N 339 THR N H2 sing N N 340 THR CA C sing N N 341 THR CA CB sing N N 342 THR CA HA sing N N 343 THR C O doub N N 344 THR C OXT sing N N 345 THR CB OG1 sing N N 346 THR CB CG2 sing N N 347 THR CB HB sing N N 348 THR OG1 HG1 sing N N 349 THR CG2 HG21 sing N N 350 THR CG2 HG22 sing N N 351 THR CG2 HG23 sing N N 352 THR OXT HXT sing N N 353 TRP N CA sing N N 354 TRP N H sing N N 355 TRP N H2 sing N N 356 TRP CA C sing N N 357 TRP CA CB sing N N 358 TRP CA HA sing N N 359 TRP C O doub N N 360 TRP C OXT sing N N 361 TRP CB CG sing N N 362 TRP CB HB2 sing N N 363 TRP CB HB3 sing N N 364 TRP CG CD1 doub Y N 365 TRP CG CD2 sing Y N 366 TRP CD1 NE1 sing Y N 367 TRP CD1 HD1 sing N N 368 TRP CD2 CE2 doub Y N 369 TRP CD2 CE3 sing Y N 370 TRP NE1 CE2 sing Y N 371 TRP NE1 HE1 sing N N 372 TRP CE2 CZ2 sing Y N 373 TRP CE3 CZ3 doub Y N 374 TRP CE3 HE3 sing N N 375 TRP CZ2 CH2 doub Y N 376 TRP CZ2 HZ2 sing N N 377 TRP CZ3 CH2 sing Y N 378 TRP CZ3 HZ3 sing N N 379 TRP CH2 HH2 sing N N 380 TRP OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1SH4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O # loop_