data_1SPV # _entry.id 1SPV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1SPV RCSB RCSB021899 WWPDB D_1000021899 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ER58 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SPV _pdbx_database_status.recvd_initial_deposition_date 2004-03-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Lee, I.' 2 'Vorobiev, S.M.' 3 'Xiao, R.' 4 'Acton, T.B.' 5 'Montelione, G.T.' 6 'Hunt, J.F.' 7 'Tong, L.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 # _citation.id primary _citation.title 'Crystal Structure of the Putative Phosphatase of Escherichia coli, Northeast Structural Genomoics Target ER58' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Forouhar, F.' 1 primary 'Lee, I.' 2 primary 'Vorobiev, S.M.' 3 primary 'Xiao, R.' 4 primary 'Acton, T.B.' 5 primary 'Montelione, G.T.' 6 primary 'Hunt, J.F.' 7 primary 'Tong, L.' 8 # _cell.entry_id 1SPV _cell.length_a 59.788 _cell.length_b 40.855 _cell.length_c 69.346 _cell.angle_alpha 90.00 _cell.angle_beta 103.49 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SPV _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'putative polyprotein/phosphatase' 19904.217 1 ? ? ? ? 2 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? 3 water nat water 18.015 98 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MKTRIHVVQGDITKLAVDVIVNAANPSL(MSE)GGGGVDGAIHRAAGPALLDACLKVRQQQGDCPTGHAVITLAGDLPAK AVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPAISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYF VCYDEENAHLYERLLTQQGDEEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKTRIHVVQGDITKLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDCPTGHAVITLAGDLPAKAVVH TVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPAISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYD EENAHLYERLLTQQGDEEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ER58 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 ARG n 1 5 ILE n 1 6 HIS n 1 7 VAL n 1 8 VAL n 1 9 GLN n 1 10 GLY n 1 11 ASP n 1 12 ILE n 1 13 THR n 1 14 LYS n 1 15 LEU n 1 16 ALA n 1 17 VAL n 1 18 ASP n 1 19 VAL n 1 20 ILE n 1 21 VAL n 1 22 ASN n 1 23 ALA n 1 24 ALA n 1 25 ASN n 1 26 PRO n 1 27 SER n 1 28 LEU n 1 29 MSE n 1 30 GLY n 1 31 GLY n 1 32 GLY n 1 33 GLY n 1 34 VAL n 1 35 ASP n 1 36 GLY n 1 37 ALA n 1 38 ILE n 1 39 HIS n 1 40 ARG n 1 41 ALA n 1 42 ALA n 1 43 GLY n 1 44 PRO n 1 45 ALA n 1 46 LEU n 1 47 LEU n 1 48 ASP n 1 49 ALA n 1 50 CYS n 1 51 LEU n 1 52 LYS n 1 53 VAL n 1 54 ARG n 1 55 GLN n 1 56 GLN n 1 57 GLN n 1 58 GLY n 1 59 ASP n 1 60 CYS n 1 61 PRO n 1 62 THR n 1 63 GLY n 1 64 HIS n 1 65 ALA n 1 66 VAL n 1 67 ILE n 1 68 THR n 1 69 LEU n 1 70 ALA n 1 71 GLY n 1 72 ASP n 1 73 LEU n 1 74 PRO n 1 75 ALA n 1 76 LYS n 1 77 ALA n 1 78 VAL n 1 79 VAL n 1 80 HIS n 1 81 THR n 1 82 VAL n 1 83 GLY n 1 84 PRO n 1 85 VAL n 1 86 TRP n 1 87 ARG n 1 88 GLY n 1 89 GLY n 1 90 GLU n 1 91 GLN n 1 92 ASN n 1 93 GLU n 1 94 ASP n 1 95 GLN n 1 96 LEU n 1 97 LEU n 1 98 GLN n 1 99 ASP n 1 100 ALA n 1 101 TYR n 1 102 LEU n 1 103 ASN n 1 104 SER n 1 105 LEU n 1 106 ARG n 1 107 LEU n 1 108 VAL n 1 109 ALA n 1 110 ALA n 1 111 ASN n 1 112 SER n 1 113 TYR n 1 114 THR n 1 115 SER n 1 116 VAL n 1 117 ALA n 1 118 PHE n 1 119 PRO n 1 120 ALA n 1 121 ILE n 1 122 SER n 1 123 THR n 1 124 GLY n 1 125 VAL n 1 126 TYR n 1 127 GLY n 1 128 TYR n 1 129 PRO n 1 130 ARG n 1 131 ALA n 1 132 ALA n 1 133 ALA n 1 134 ALA n 1 135 GLU n 1 136 ILE n 1 137 ALA n 1 138 VAL n 1 139 LYS n 1 140 THR n 1 141 VAL n 1 142 SER n 1 143 GLU n 1 144 PHE n 1 145 ILE n 1 146 THR n 1 147 ARG n 1 148 HIS n 1 149 ALA n 1 150 LEU n 1 151 PRO n 1 152 GLU n 1 153 GLN n 1 154 VAL n 1 155 TYR n 1 156 PHE n 1 157 VAL n 1 158 CYS n 1 159 TYR n 1 160 ASP n 1 161 GLU n 1 162 GLU n 1 163 ASN n 1 164 ALA n 1 165 HIS n 1 166 LEU n 1 167 TYR n 1 168 GLU n 1 169 ARG n 1 170 LEU n 1 171 LEU n 1 172 THR n 1 173 GLN n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 GLU n 1 178 GLU n 1 179 HIS n 1 180 HIS n 1 181 HIS n 1 182 HIS n 1 183 HIS n 1 184 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YMDB_ECOLI _struct_ref.pdbx_db_accession P0A8D6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKTRIHVVQGDITKLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDCPTGHAVITLAGDLPAKAVVH TVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPAISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYD EENAHLYERLLTQQGDE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SPV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 177 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A8D6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 177 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 177 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1SPV MSE A 29 ? UNP P0A8D6 MET 29 'MODIFIED RESIDUE' 29 1 1 1SPV GLU A 177 ? UNP P0A8D6 ? ? 'CLONING ARTIFACT' 177 2 1 1SPV GLU A 178 ? UNP P0A8D6 ? ? 'CLONING ARTIFACT' 178 3 1 1SPV HIS A 179 ? UNP P0A8D6 ? ? 'CLONING ARTIFACT' 179 4 1 1SPV HIS A 180 ? UNP P0A8D6 ? ? 'CLONING ARTIFACT' 180 5 1 1SPV HIS A 181 ? UNP P0A8D6 ? ? 'CLONING ARTIFACT' 181 6 1 1SPV HIS A 182 ? UNP P0A8D6 ? ? 'CLONING ARTIFACT' 182 7 1 1SPV HIS A 183 ? UNP P0A8D6 ? ? 'CLONING ARTIFACT' 183 8 1 1SPV HIS A 184 ? UNP P0A8D6 ? ? 'CLONING ARTIFACT' 184 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1SPV _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 45.13 _exptl_crystal.description ? _exptl_crystal.density_Matthews 2.26 # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_details ;Well solution: 12% PEG 20K, 100mM MES pH 5.75, 30mM KH2PO4. Protein Solution: 10mM Tris pH 7.5, 5mM DTT, 100mM NaCl, VAPOR DIFFUSION, HANGING DROP, temperature 277K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2004-03-08 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97927 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97927 # _reflns.entry_id 1SPV _reflns.observed_criterion_sigma_F 2.0 _reflns.observed_criterion_sigma_I 2.0 _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 29.29 _reflns.number_all ? _reflns.number_obs 22088 _reflns.percent_possible_obs 99.2 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value 0.065 _reflns.pdbx_netI_over_sigmaI 18.84 _reflns.B_iso_Wilson_estimate 9.5 _reflns.pdbx_redundancy 4.15 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 97.3 _reflns_shell.Rmerge_I_obs 0.11 _reflns_shell.pdbx_Rsym_value 0.116 _reflns_shell.meanI_over_sigI_obs 7.7 _reflns_shell.pdbx_redundancy 3.2 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 2214 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1SPV _refine.ls_d_res_high 2.0 _refine.ls_d_res_low 29.29 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_ls_sigma_I 2.0 _refine.ls_number_reflns_all 21071 _refine.ls_number_reflns_obs 21071 _refine.ls_number_reflns_R_free 2004 _refine.ls_percent_reflns_obs 97.9 _refine.ls_R_factor_all 0.201 _refine.ls_R_factor_obs 0.232 _refine.ls_R_factor_R_work 0.201 _refine.ls_R_factor_R_free 0.232 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model anisotropic _refine.B_iso_mean 22.1 _refine.aniso_B[1][1] 0.21 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.57 _refine.aniso_B[2][2] 0.55 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.76 _refine.details 'Used weighted full matrix least squares procedure' _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1SPV _refine_analyze.Luzzati_coordinate_error_obs 0.22 _refine_analyze.Luzzati_sigma_a_obs 0.11 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.28 _refine_analyze.Luzzati_sigma_a_free 0.22 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1290 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 98 _refine_hist.number_atoms_total 1400 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 29.29 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.005 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d 1.1 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.0 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.86 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 2.0 _refine_ls_shell.d_res_low 2.13 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.222 _refine_ls_shell.percent_reflns_obs 94.3 _refine_ls_shell.R_factor_R_free 0.29 _refine_ls_shell.R_factor_R_free_error 0.018 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 272 _refine_ls_shell.number_reflns_obs 3109 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1SPV _struct.title 'Crystal Structure of the Putative Phosphatase of Escherichia coli, Northeast Structural Genomoics Target ER58' _struct.pdbx_descriptor 'putative polyprotein/phosphatase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SPV _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Structural Genomoics, alpha/beta monomeric protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 11 ? LEU A 15 ? ASP A 11 LEU A 15 5 ? 5 HELX_P HELX_P2 2 GLY A 32 ? GLY A 43 ? GLY A 32 GLY A 43 1 ? 12 HELX_P HELX_P3 3 GLY A 43 ? GLY A 58 ? GLY A 43 GLY A 58 1 ? 16 HELX_P HELX_P4 4 ASN A 92 ? ASN A 111 ? ASN A 92 ASN A 111 1 ? 20 HELX_P HELX_P5 5 PRO A 129 ? HIS A 148 ? PRO A 129 HIS A 148 1 ? 20 HELX_P HELX_P6 6 ASP A 160 ? GLN A 173 ? ASP A 160 GLN A 173 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A LEU 28 C ? ? ? 1_555 A MSE 29 N ? ? A LEU 28 A MSE 29 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale ? ? A MSE 29 C ? ? ? 1_555 A GLY 30 N ? ? A MSE 29 A GLY 30 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 150 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 150 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 151 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 151 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.19 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 5 ? GLN A 9 ? ILE A 5 GLN A 9 A 2 GLN A 153 ? CYS A 158 ? GLN A 153 CYS A 158 A 3 SER A 115 ? PHE A 118 ? SER A 115 PHE A 118 A 4 VAL A 19 ? ALA A 23 ? VAL A 19 ALA A 23 A 5 ALA A 77 ? THR A 81 ? ALA A 77 THR A 81 A 6 ALA A 65 ? THR A 68 ? ALA A 65 THR A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 6 ? N HIS A 6 O PHE A 156 ? O PHE A 156 A 2 3 O TYR A 155 ? O TYR A 155 N PHE A 118 ? N PHE A 118 A 3 4 O ALA A 117 ? O ALA A 117 N VAL A 21 ? N VAL A 21 A 4 5 N ASN A 22 ? N ASN A 22 O VAL A 79 ? O VAL A 79 A 5 6 O HIS A 80 ? O HIS A 80 N VAL A 66 ? N VAL A 66 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'BINDING SITE FOR RESIDUE MES A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 ALA A 23 ? ALA A 23 . ? 1_555 ? 2 AC1 10 ASN A 25 ? ASN A 25 . ? 1_555 ? 3 AC1 10 GLY A 32 ? GLY A 32 . ? 1_555 ? 4 AC1 10 ASP A 35 ? ASP A 35 . ? 1_555 ? 5 AC1 10 ASP A 48 ? ASP A 48 . ? 4_646 ? 6 AC1 10 SER A 122 ? SER A 122 . ? 1_555 ? 7 AC1 10 GLY A 124 ? GLY A 124 . ? 1_555 ? 8 AC1 10 VAL A 125 ? VAL A 125 . ? 1_555 ? 9 AC1 10 TYR A 126 ? TYR A 126 . ? 1_555 ? 10 AC1 10 HOH C . ? HOH A 275 . ? 1_555 ? # _database_PDB_matrix.entry_id 1SPV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1SPV _atom_sites.fract_transf_matrix[1][1] 0.016726 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004012 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024477 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014830 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 MSE 29 29 29 MSE MSE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 CYS 158 158 158 CYS CYS A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 GLY 175 175 ? ? ? A . n A 1 176 ASP 176 176 ? ? ? A . n A 1 177 GLU 177 177 ? ? ? A . n A 1 178 GLU 178 178 ? ? ? A . n A 1 179 HIS 179 179 ? ? ? A . n A 1 180 HIS 180 180 ? ? ? A . n A 1 181 HIS 181 181 ? ? ? A . n A 1 182 HIS 182 182 ? ? ? A . n A 1 183 HIS 183 183 ? ? ? A . n A 1 184 HIS 184 184 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MES 1 201 201 MES MES A . C 3 HOH 1 202 1 HOH HOH A . C 3 HOH 2 203 2 HOH HOH A . C 3 HOH 3 204 3 HOH HOH A . C 3 HOH 4 205 4 HOH HOH A . C 3 HOH 5 206 5 HOH HOH A . C 3 HOH 6 207 6 HOH HOH A . C 3 HOH 7 208 7 HOH HOH A . C 3 HOH 8 209 8 HOH HOH A . C 3 HOH 9 210 9 HOH HOH A . C 3 HOH 10 211 10 HOH HOH A . C 3 HOH 11 212 11 HOH HOH A . C 3 HOH 12 213 12 HOH HOH A . C 3 HOH 13 214 13 HOH HOH A . C 3 HOH 14 215 14 HOH HOH A . C 3 HOH 15 216 15 HOH HOH A . C 3 HOH 16 217 16 HOH HOH A . C 3 HOH 17 218 17 HOH HOH A . C 3 HOH 18 219 18 HOH HOH A . C 3 HOH 19 220 19 HOH HOH A . C 3 HOH 20 221 20 HOH HOH A . C 3 HOH 21 222 21 HOH HOH A . C 3 HOH 22 223 22 HOH HOH A . C 3 HOH 23 224 23 HOH HOH A . C 3 HOH 24 225 24 HOH HOH A . C 3 HOH 25 226 25 HOH HOH A . C 3 HOH 26 227 26 HOH HOH A . C 3 HOH 27 228 27 HOH HOH A . C 3 HOH 28 229 28 HOH HOH A . C 3 HOH 29 230 29 HOH HOH A . C 3 HOH 30 231 30 HOH HOH A . C 3 HOH 31 232 31 HOH HOH A . C 3 HOH 32 233 32 HOH HOH A . C 3 HOH 33 234 33 HOH HOH A . C 3 HOH 34 235 34 HOH HOH A . C 3 HOH 35 236 35 HOH HOH A . C 3 HOH 36 237 36 HOH HOH A . C 3 HOH 37 238 37 HOH HOH A . C 3 HOH 38 239 38 HOH HOH A . C 3 HOH 39 240 39 HOH HOH A . C 3 HOH 40 241 40 HOH HOH A . C 3 HOH 41 242 41 HOH HOH A . C 3 HOH 42 243 42 HOH HOH A . C 3 HOH 43 244 43 HOH HOH A . C 3 HOH 44 245 44 HOH HOH A . C 3 HOH 45 246 45 HOH HOH A . C 3 HOH 46 247 46 HOH HOH A . C 3 HOH 47 248 47 HOH HOH A . C 3 HOH 48 249 48 HOH HOH A . C 3 HOH 49 250 49 HOH HOH A . C 3 HOH 50 251 50 HOH HOH A . C 3 HOH 51 252 51 HOH HOH A . C 3 HOH 52 253 52 HOH HOH A . C 3 HOH 53 254 53 HOH HOH A . C 3 HOH 54 255 54 HOH HOH A . C 3 HOH 55 256 55 HOH HOH A . C 3 HOH 56 257 56 HOH HOH A . C 3 HOH 57 258 57 HOH HOH A . C 3 HOH 58 259 58 HOH HOH A . C 3 HOH 59 260 59 HOH HOH A . C 3 HOH 60 261 60 HOH HOH A . C 3 HOH 61 262 61 HOH HOH A . C 3 HOH 62 263 62 HOH HOH A . C 3 HOH 63 264 63 HOH HOH A . C 3 HOH 64 265 64 HOH HOH A . C 3 HOH 65 266 65 HOH HOH A . C 3 HOH 66 267 66 HOH HOH A . C 3 HOH 67 268 67 HOH HOH A . C 3 HOH 68 269 68 HOH HOH A . C 3 HOH 69 270 69 HOH HOH A . C 3 HOH 70 271 70 HOH HOH A . C 3 HOH 71 272 71 HOH HOH A . C 3 HOH 72 273 72 HOH HOH A . C 3 HOH 73 274 73 HOH HOH A . C 3 HOH 74 275 74 HOH HOH A . C 3 HOH 75 276 75 HOH HOH A . C 3 HOH 76 277 76 HOH HOH A . C 3 HOH 77 278 77 HOH HOH A . C 3 HOH 78 279 78 HOH HOH A . C 3 HOH 79 280 79 HOH HOH A . C 3 HOH 80 281 80 HOH HOH A . C 3 HOH 81 282 81 HOH HOH A . C 3 HOH 82 283 82 HOH HOH A . C 3 HOH 83 284 83 HOH HOH A . C 3 HOH 84 285 84 HOH HOH A . C 3 HOH 85 286 85 HOH HOH A . C 3 HOH 86 287 86 HOH HOH A . C 3 HOH 87 288 87 HOH HOH A . C 3 HOH 88 289 88 HOH HOH A . C 3 HOH 89 290 89 HOH HOH A . C 3 HOH 90 291 90 HOH HOH A . C 3 HOH 91 292 91 HOH HOH A . C 3 HOH 92 293 92 HOH HOH A . C 3 HOH 93 294 93 HOH HOH A . C 3 HOH 94 295 94 HOH HOH A . C 3 HOH 95 296 95 HOH HOH A . C 3 HOH 96 297 96 HOH HOH A . C 3 HOH 97 298 97 HOH HOH A . C 3 HOH 98 299 98 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 29 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 29 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-06 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 Shake 'model building' '& Bake' ? 3 CNS refinement . ? 4 SnB phasing . ? 5 SOLVE phasing . ? 6 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 284 ? ? 1_555 O A HOH 284 ? ? 2_656 1.07 2 1 O A HOH 282 ? ? 1_555 O A HOH 282 ? ? 2_656 1.18 3 1 O A HOH 283 ? ? 1_555 O A HOH 283 ? ? 2_656 1.45 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 74 ? ? -81.91 46.94 2 1 ASN A 92 ? ? 58.73 15.24 3 1 SER A 122 ? ? 70.19 -5.18 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A GLY 175 ? A GLY 175 4 1 Y 1 A ASP 176 ? A ASP 176 5 1 Y 1 A GLU 177 ? A GLU 177 6 1 Y 1 A GLU 178 ? A GLU 178 7 1 Y 1 A HIS 179 ? A HIS 179 8 1 Y 1 A HIS 180 ? A HIS 180 9 1 Y 1 A HIS 181 ? A HIS 181 10 1 Y 1 A HIS 182 ? A HIS 182 11 1 Y 1 A HIS 183 ? A HIS 183 12 1 Y 1 A HIS 184 ? A HIS 184 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 3 water HOH #