data_1SRB # _entry.id 1SRB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SRB pdb_00001srb 10.2210/pdb1srb/pdb WWPDB D_1000176474 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-11-01 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SRB _pdbx_database_status.recvd_initial_deposition_date 1994-09-06 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Smith, R.' 1 'Atkins, A.R.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary '1H NMR studies of sarafotoxin SRTb, a nonselective endothelin receptor agonist, and IRL 1620, an ETB receptor-specific agonist.' Biochemistry 34 2026 2033 1995 BICHAW US 0006-2960 0033 ? 7849060 10.1021/bi00006a024 1 'Conformation of Sarafotoxin-6B in Aqueous Solution Determined by NMR Spectroscopy and Distance Geometry' 'FEBS Lett.' 282 247 ? 1991 FEBLAL NE 0014-5793 0165 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Atkins, A.R.' 1 ? primary 'Martin, R.C.' 2 ? primary 'Smith, R.' 3 ? 1 'Mills, R.G.' 4 ? 1 'Atkins, A.R.' 5 ? 1 'Harvey, T.' 6 ? 1 'Junius, F.K.' 7 ? 1 'Smith, R.' 8 ? 1 'King, G.F.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sarafotoxins precursor' _entity.formula_weight 2570.980 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CSCKDMTDKECLYFCHQDVIW _entity_poly.pdbx_seq_one_letter_code_can CSCKDMTDKECLYFCHQDVIW _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 SER n 1 3 CYS n 1 4 LYS n 1 5 ASP n 1 6 MET n 1 7 THR n 1 8 ASP n 1 9 LYS n 1 10 GLU n 1 11 CYS n 1 12 LEU n 1 13 TYR n 1 14 PHE n 1 15 CYS n 1 16 HIS n 1 17 GLN n 1 18 ASP n 1 19 VAL n 1 20 ILE n 1 21 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Atractaspis _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Atractaspis microlepidota' _entity_src_gen.gene_src_strain andersoni _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Atractaspis microlepidota andersoni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8600 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 TRP 21 21 21 TRP TRP A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 1SRB _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SRB _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1SRB _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1SRB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1SRB _struct.title 'CONFORMATIONAL STUDIES ON SRTB, A NON-SELECTIVE ENDOTHELIN RECEPTOR AGONIST, AND ON IRL 1620, AN ETB RECEPTOR SPECIFIC AGONIST' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SRB _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SRTX_ATREN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P13208 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MALLPRLAAGGLLLLLALAALEGKPAPSALSQLLEKRSEDQAAAGRIIDGGDTKQAARDPSPQRNVEPLCSCKDMSDKEC LNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCSCKDMTDKEC LYFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEEC LNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCKDMTDKECLYFCHQGIIWRDTKQAARDPSPQRNVEPLCSCKDMSDKEC LNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEEC LNFCHQDVIWRDTKQAARDPSPQRNVEPLCSCKDMTDKECLYFCHQDVIWRDTKQAARDPSPQRNVEPLCSCKDMSDKEC LNFCHQDVIWRDTKQAARDPSPQRNVEPLCSCKDMTDKECLNFCHQDVIWKNADTSANPEFLG ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SRB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 21 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P13208 _struct_ref_seq.db_align_beg 430 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 450 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 8 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 16 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 8 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 16 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 1 A CYS 15 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf2 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 3 A CYS 11 1_555 ? ? ? ? ? ? ? 2.019 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 1 ? CYS A 15 ? CYS A 1 ? 1_555 CYS A 15 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 3 ? CYS A 11 ? CYS A 3 ? 1_555 CYS A 11 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 1SRB _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A TRP 21 ? ? CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? 103.95 110.10 -6.15 1.00 N 2 1 CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? 116.65 109.00 7.65 0.90 N 3 2 CG A TRP 21 ? ? CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? 103.14 110.10 -6.96 1.00 N 4 2 CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? 117.16 109.00 8.16 0.90 N 5 2 NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? CZ2 A TRP 21 ? ? 137.28 130.40 6.88 1.10 N 6 3 CG A TRP 21 ? ? CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? 103.21 110.10 -6.89 1.00 N 7 3 CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? 117.17 109.00 8.17 0.90 N 8 3 NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? CZ2 A TRP 21 ? ? 137.50 130.40 7.10 1.10 N 9 4 CG A TRP 21 ? ? CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? 104.07 110.10 -6.03 1.00 N 10 4 CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? 116.46 109.00 7.46 0.90 N 11 5 CG A TRP 21 ? ? CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? 103.16 110.10 -6.94 1.00 N 12 5 CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? 117.26 109.00 8.26 0.90 N 13 5 NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? CZ2 A TRP 21 ? ? 138.05 130.40 7.65 1.10 N 14 6 CG A TRP 21 ? ? CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? 103.83 110.10 -6.27 1.00 N 15 6 CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? 116.83 109.00 7.83 0.90 N 16 6 NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? CZ2 A TRP 21 ? ? 137.03 130.40 6.63 1.10 N 17 7 CG A TRP 21 ? ? CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? 103.19 110.10 -6.91 1.00 N 18 7 CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? 117.07 109.00 8.07 0.90 N 19 8 CB A TRP 21 ? ? CG A TRP 21 ? ? CD1 A TRP 21 ? ? 119.18 127.00 -7.82 1.30 N 20 8 CG A TRP 21 ? ? CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? 103.95 110.10 -6.15 1.00 N 21 8 CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? 116.61 109.00 7.61 0.90 N 22 9 CG A TRP 21 ? ? CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? 103.09 110.10 -7.01 1.00 N 23 9 CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? 117.25 109.00 8.25 0.90 N 24 9 NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? CZ2 A TRP 21 ? ? 137.94 130.40 7.54 1.10 N 25 10 CG A TRP 21 ? ? CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? 103.47 110.10 -6.63 1.00 N 26 10 CD1 A TRP 21 ? ? NE1 A TRP 21 ? ? CE2 A TRP 21 ? ? 116.87 109.00 7.87 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 5 ? ? 100.80 21.64 2 1 THR A 7 ? ? -110.72 -145.40 3 1 TYR A 13 ? ? -58.13 -3.91 4 1 HIS A 16 ? ? -102.74 40.08 5 1 ASP A 18 ? ? -107.02 70.22 6 2 SER A 2 ? ? 14.97 83.75 7 2 GLN A 17 ? ? 69.92 67.92 8 2 ASP A 18 ? ? -106.14 73.25 9 3 LYS A 4 ? ? -24.50 126.16 10 3 ASP A 5 ? ? 33.69 35.00 11 3 THR A 7 ? ? -110.61 -159.14 12 3 ASP A 8 ? ? -103.20 -61.46 13 3 LYS A 9 ? ? -37.25 -36.46 14 3 CYS A 15 ? ? -99.91 -63.05 15 3 GLN A 17 ? ? -118.59 51.22 16 4 ASP A 5 ? ? 90.34 37.53 17 4 THR A 7 ? ? -107.50 -114.86 18 4 ASP A 8 ? ? -130.18 -64.83 19 4 TYR A 13 ? ? -45.77 -18.70 20 4 ASP A 18 ? ? -125.26 -73.51 21 5 CYS A 3 ? ? -104.08 58.96 22 5 THR A 7 ? ? -108.89 -157.07 23 5 ASP A 8 ? ? -105.47 -67.74 24 5 HIS A 16 ? ? -133.95 -47.22 25 6 ASP A 5 ? ? 29.44 35.18 26 6 THR A 7 ? ? -112.83 -136.87 27 6 TYR A 13 ? ? -37.12 -27.54 28 6 ASP A 18 ? ? -119.78 -82.10 29 7 CYS A 3 ? ? -130.92 -48.42 30 7 LYS A 4 ? ? 9.61 58.11 31 7 ASP A 5 ? ? 166.54 -44.49 32 7 THR A 7 ? ? -94.39 -94.20 33 7 ASP A 8 ? ? -145.02 -60.05 34 7 TYR A 13 ? ? -38.71 -34.76 35 8 LYS A 4 ? ? 54.40 82.80 36 8 THR A 7 ? ? -100.65 -153.18 37 8 ASP A 8 ? ? -108.57 -61.96 38 8 HIS A 16 ? ? -90.40 -66.05 39 8 ASP A 18 ? ? -25.35 -67.00 40 9 CYS A 3 ? ? -114.28 69.56 41 9 ASP A 8 ? ? 76.60 -66.20 42 9 HIS A 16 ? ? -94.29 36.90 43 10 THR A 7 ? ? -111.99 -154.40 44 10 ASP A 8 ? ? -98.42 -75.27 45 10 GLN A 17 ? ? -112.32 54.26 # _pdbx_nmr_ensemble.entry_id 1SRB _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ASP N N N N 1 ASP CA C N S 2 ASP C C N N 3 ASP O O N N 4 ASP CB C N N 5 ASP CG C N N 6 ASP OD1 O N N 7 ASP OD2 O N N 8 ASP OXT O N N 9 ASP H H N N 10 ASP H2 H N N 11 ASP HA H N N 12 ASP HB2 H N N 13 ASP HB3 H N N 14 ASP HD2 H N N 15 ASP HXT H N N 16 CYS N N N N 17 CYS CA C N R 18 CYS C C N N 19 CYS O O N N 20 CYS CB C N N 21 CYS SG S N N 22 CYS OXT O N N 23 CYS H H N N 24 CYS H2 H N N 25 CYS HA H N N 26 CYS HB2 H N N 27 CYS HB3 H N N 28 CYS HG H N N 29 CYS HXT H N N 30 GLN N N N N 31 GLN CA C N S 32 GLN C C N N 33 GLN O O N N 34 GLN CB C N N 35 GLN CG C N N 36 GLN CD C N N 37 GLN OE1 O N N 38 GLN NE2 N N N 39 GLN OXT O N N 40 GLN H H N N 41 GLN H2 H N N 42 GLN HA H N N 43 GLN HB2 H N N 44 GLN HB3 H N N 45 GLN HG2 H N N 46 GLN HG3 H N N 47 GLN HE21 H N N 48 GLN HE22 H N N 49 GLN HXT H N N 50 GLU N N N N 51 GLU CA C N S 52 GLU C C N N 53 GLU O O N N 54 GLU CB C N N 55 GLU CG C N N 56 GLU CD C N N 57 GLU OE1 O N N 58 GLU OE2 O N N 59 GLU OXT O N N 60 GLU H H N N 61 GLU H2 H N N 62 GLU HA H N N 63 GLU HB2 H N N 64 GLU HB3 H N N 65 GLU HG2 H N N 66 GLU HG3 H N N 67 GLU HE2 H N N 68 GLU HXT H N N 69 HIS N N N N 70 HIS CA C N S 71 HIS C C N N 72 HIS O O N N 73 HIS CB C N N 74 HIS CG C Y N 75 HIS ND1 N Y N 76 HIS CD2 C Y N 77 HIS CE1 C Y N 78 HIS NE2 N Y N 79 HIS OXT O N N 80 HIS H H N N 81 HIS H2 H N N 82 HIS HA H N N 83 HIS HB2 H N N 84 HIS HB3 H N N 85 HIS HD1 H N N 86 HIS HD2 H N N 87 HIS HE1 H N N 88 HIS HE2 H N N 89 HIS HXT H N N 90 ILE N N N N 91 ILE CA C N S 92 ILE C C N N 93 ILE O O N N 94 ILE CB C N S 95 ILE CG1 C N N 96 ILE CG2 C N N 97 ILE CD1 C N N 98 ILE OXT O N N 99 ILE H H N N 100 ILE H2 H N N 101 ILE HA H N N 102 ILE HB H N N 103 ILE HG12 H N N 104 ILE HG13 H N N 105 ILE HG21 H N N 106 ILE HG22 H N N 107 ILE HG23 H N N 108 ILE HD11 H N N 109 ILE HD12 H N N 110 ILE HD13 H N N 111 ILE HXT H N N 112 LEU N N N N 113 LEU CA C N S 114 LEU C C N N 115 LEU O O N N 116 LEU CB C N N 117 LEU CG C N N 118 LEU CD1 C N N 119 LEU CD2 C N N 120 LEU OXT O N N 121 LEU H H N N 122 LEU H2 H N N 123 LEU HA H N N 124 LEU HB2 H N N 125 LEU HB3 H N N 126 LEU HG H N N 127 LEU HD11 H N N 128 LEU HD12 H N N 129 LEU HD13 H N N 130 LEU HD21 H N N 131 LEU HD22 H N N 132 LEU HD23 H N N 133 LEU HXT H N N 134 LYS N N N N 135 LYS CA C N S 136 LYS C C N N 137 LYS O O N N 138 LYS CB C N N 139 LYS CG C N N 140 LYS CD C N N 141 LYS CE C N N 142 LYS NZ N N N 143 LYS OXT O N N 144 LYS H H N N 145 LYS H2 H N N 146 LYS HA H N N 147 LYS HB2 H N N 148 LYS HB3 H N N 149 LYS HG2 H N N 150 LYS HG3 H N N 151 LYS HD2 H N N 152 LYS HD3 H N N 153 LYS HE2 H N N 154 LYS HE3 H N N 155 LYS HZ1 H N N 156 LYS HZ2 H N N 157 LYS HZ3 H N N 158 LYS HXT H N N 159 MET N N N N 160 MET CA C N S 161 MET C C N N 162 MET O O N N 163 MET CB C N N 164 MET CG C N N 165 MET SD S N N 166 MET CE C N N 167 MET OXT O N N 168 MET H H N N 169 MET H2 H N N 170 MET HA H N N 171 MET HB2 H N N 172 MET HB3 H N N 173 MET HG2 H N N 174 MET HG3 H N N 175 MET HE1 H N N 176 MET HE2 H N N 177 MET HE3 H N N 178 MET HXT H N N 179 PHE N N N N 180 PHE CA C N S 181 PHE C C N N 182 PHE O O N N 183 PHE CB C N N 184 PHE CG C Y N 185 PHE CD1 C Y N 186 PHE CD2 C Y N 187 PHE CE1 C Y N 188 PHE CE2 C Y N 189 PHE CZ C Y N 190 PHE OXT O N N 191 PHE H H N N 192 PHE H2 H N N 193 PHE HA H N N 194 PHE HB2 H N N 195 PHE HB3 H N N 196 PHE HD1 H N N 197 PHE HD2 H N N 198 PHE HE1 H N N 199 PHE HE2 H N N 200 PHE HZ H N N 201 PHE HXT H N N 202 SER N N N N 203 SER CA C N S 204 SER C C N N 205 SER O O N N 206 SER CB C N N 207 SER OG O N N 208 SER OXT O N N 209 SER H H N N 210 SER H2 H N N 211 SER HA H N N 212 SER HB2 H N N 213 SER HB3 H N N 214 SER HG H N N 215 SER HXT H N N 216 THR N N N N 217 THR CA C N S 218 THR C C N N 219 THR O O N N 220 THR CB C N R 221 THR OG1 O N N 222 THR CG2 C N N 223 THR OXT O N N 224 THR H H N N 225 THR H2 H N N 226 THR HA H N N 227 THR HB H N N 228 THR HG1 H N N 229 THR HG21 H N N 230 THR HG22 H N N 231 THR HG23 H N N 232 THR HXT H N N 233 TRP N N N N 234 TRP CA C N S 235 TRP C C N N 236 TRP O O N N 237 TRP CB C N N 238 TRP CG C Y N 239 TRP CD1 C Y N 240 TRP CD2 C Y N 241 TRP NE1 N Y N 242 TRP CE2 C Y N 243 TRP CE3 C Y N 244 TRP CZ2 C Y N 245 TRP CZ3 C Y N 246 TRP CH2 C Y N 247 TRP OXT O N N 248 TRP H H N N 249 TRP H2 H N N 250 TRP HA H N N 251 TRP HB2 H N N 252 TRP HB3 H N N 253 TRP HD1 H N N 254 TRP HE1 H N N 255 TRP HE3 H N N 256 TRP HZ2 H N N 257 TRP HZ3 H N N 258 TRP HH2 H N N 259 TRP HXT H N N 260 TYR N N N N 261 TYR CA C N S 262 TYR C C N N 263 TYR O O N N 264 TYR CB C N N 265 TYR CG C Y N 266 TYR CD1 C Y N 267 TYR CD2 C Y N 268 TYR CE1 C Y N 269 TYR CE2 C Y N 270 TYR CZ C Y N 271 TYR OH O N N 272 TYR OXT O N N 273 TYR H H N N 274 TYR H2 H N N 275 TYR HA H N N 276 TYR HB2 H N N 277 TYR HB3 H N N 278 TYR HD1 H N N 279 TYR HD2 H N N 280 TYR HE1 H N N 281 TYR HE2 H N N 282 TYR HH H N N 283 TYR HXT H N N 284 VAL N N N N 285 VAL CA C N S 286 VAL C C N N 287 VAL O O N N 288 VAL CB C N N 289 VAL CG1 C N N 290 VAL CG2 C N N 291 VAL OXT O N N 292 VAL H H N N 293 VAL H2 H N N 294 VAL HA H N N 295 VAL HB H N N 296 VAL HG11 H N N 297 VAL HG12 H N N 298 VAL HG13 H N N 299 VAL HG21 H N N 300 VAL HG22 H N N 301 VAL HG23 H N N 302 VAL HXT H N N 303 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ASP N CA sing N N 1 ASP N H sing N N 2 ASP N H2 sing N N 3 ASP CA C sing N N 4 ASP CA CB sing N N 5 ASP CA HA sing N N 6 ASP C O doub N N 7 ASP C OXT sing N N 8 ASP CB CG sing N N 9 ASP CB HB2 sing N N 10 ASP CB HB3 sing N N 11 ASP CG OD1 doub N N 12 ASP CG OD2 sing N N 13 ASP OD2 HD2 sing N N 14 ASP OXT HXT sing N N 15 CYS N CA sing N N 16 CYS N H sing N N 17 CYS N H2 sing N N 18 CYS CA C sing N N 19 CYS CA CB sing N N 20 CYS CA HA sing N N 21 CYS C O doub N N 22 CYS C OXT sing N N 23 CYS CB SG sing N N 24 CYS CB HB2 sing N N 25 CYS CB HB3 sing N N 26 CYS SG HG sing N N 27 CYS OXT HXT sing N N 28 GLN N CA sing N N 29 GLN N H sing N N 30 GLN N H2 sing N N 31 GLN CA C sing N N 32 GLN CA CB sing N N 33 GLN CA HA sing N N 34 GLN C O doub N N 35 GLN C OXT sing N N 36 GLN CB CG sing N N 37 GLN CB HB2 sing N N 38 GLN CB HB3 sing N N 39 GLN CG CD sing N N 40 GLN CG HG2 sing N N 41 GLN CG HG3 sing N N 42 GLN CD OE1 doub N N 43 GLN CD NE2 sing N N 44 GLN NE2 HE21 sing N N 45 GLN NE2 HE22 sing N N 46 GLN OXT HXT sing N N 47 GLU N CA sing N N 48 GLU N H sing N N 49 GLU N H2 sing N N 50 GLU CA C sing N N 51 GLU CA CB sing N N 52 GLU CA HA sing N N 53 GLU C O doub N N 54 GLU C OXT sing N N 55 GLU CB CG sing N N 56 GLU CB HB2 sing N N 57 GLU CB HB3 sing N N 58 GLU CG CD sing N N 59 GLU CG HG2 sing N N 60 GLU CG HG3 sing N N 61 GLU CD OE1 doub N N 62 GLU CD OE2 sing N N 63 GLU OE2 HE2 sing N N 64 GLU OXT HXT sing N N 65 HIS N CA sing N N 66 HIS N H sing N N 67 HIS N H2 sing N N 68 HIS CA C sing N N 69 HIS CA CB sing N N 70 HIS CA HA sing N N 71 HIS C O doub N N 72 HIS C OXT sing N N 73 HIS CB CG sing N N 74 HIS CB HB2 sing N N 75 HIS CB HB3 sing N N 76 HIS CG ND1 sing Y N 77 HIS CG CD2 doub Y N 78 HIS ND1 CE1 doub Y N 79 HIS ND1 HD1 sing N N 80 HIS CD2 NE2 sing Y N 81 HIS CD2 HD2 sing N N 82 HIS CE1 NE2 sing Y N 83 HIS CE1 HE1 sing N N 84 HIS NE2 HE2 sing N N 85 HIS OXT HXT sing N N 86 ILE N CA sing N N 87 ILE N H sing N N 88 ILE N H2 sing N N 89 ILE CA C sing N N 90 ILE CA CB sing N N 91 ILE CA HA sing N N 92 ILE C O doub N N 93 ILE C OXT sing N N 94 ILE CB CG1 sing N N 95 ILE CB CG2 sing N N 96 ILE CB HB sing N N 97 ILE CG1 CD1 sing N N 98 ILE CG1 HG12 sing N N 99 ILE CG1 HG13 sing N N 100 ILE CG2 HG21 sing N N 101 ILE CG2 HG22 sing N N 102 ILE CG2 HG23 sing N N 103 ILE CD1 HD11 sing N N 104 ILE CD1 HD12 sing N N 105 ILE CD1 HD13 sing N N 106 ILE OXT HXT sing N N 107 LEU N CA sing N N 108 LEU N H sing N N 109 LEU N H2 sing N N 110 LEU CA C sing N N 111 LEU CA CB sing N N 112 LEU CA HA sing N N 113 LEU C O doub N N 114 LEU C OXT sing N N 115 LEU CB CG sing N N 116 LEU CB HB2 sing N N 117 LEU CB HB3 sing N N 118 LEU CG CD1 sing N N 119 LEU CG CD2 sing N N 120 LEU CG HG sing N N 121 LEU CD1 HD11 sing N N 122 LEU CD1 HD12 sing N N 123 LEU CD1 HD13 sing N N 124 LEU CD2 HD21 sing N N 125 LEU CD2 HD22 sing N N 126 LEU CD2 HD23 sing N N 127 LEU OXT HXT sing N N 128 LYS N CA sing N N 129 LYS N H sing N N 130 LYS N H2 sing N N 131 LYS CA C sing N N 132 LYS CA CB sing N N 133 LYS CA HA sing N N 134 LYS C O doub N N 135 LYS C OXT sing N N 136 LYS CB CG sing N N 137 LYS CB HB2 sing N N 138 LYS CB HB3 sing N N 139 LYS CG CD sing N N 140 LYS CG HG2 sing N N 141 LYS CG HG3 sing N N 142 LYS CD CE sing N N 143 LYS CD HD2 sing N N 144 LYS CD HD3 sing N N 145 LYS CE NZ sing N N 146 LYS CE HE2 sing N N 147 LYS CE HE3 sing N N 148 LYS NZ HZ1 sing N N 149 LYS NZ HZ2 sing N N 150 LYS NZ HZ3 sing N N 151 LYS OXT HXT sing N N 152 MET N CA sing N N 153 MET N H sing N N 154 MET N H2 sing N N 155 MET CA C sing N N 156 MET CA CB sing N N 157 MET CA HA sing N N 158 MET C O doub N N 159 MET C OXT sing N N 160 MET CB CG sing N N 161 MET CB HB2 sing N N 162 MET CB HB3 sing N N 163 MET CG SD sing N N 164 MET CG HG2 sing N N 165 MET CG HG3 sing N N 166 MET SD CE sing N N 167 MET CE HE1 sing N N 168 MET CE HE2 sing N N 169 MET CE HE3 sing N N 170 MET OXT HXT sing N N 171 PHE N CA sing N N 172 PHE N H sing N N 173 PHE N H2 sing N N 174 PHE CA C sing N N 175 PHE CA CB sing N N 176 PHE CA HA sing N N 177 PHE C O doub N N 178 PHE C OXT sing N N 179 PHE CB CG sing N N 180 PHE CB HB2 sing N N 181 PHE CB HB3 sing N N 182 PHE CG CD1 doub Y N 183 PHE CG CD2 sing Y N 184 PHE CD1 CE1 sing Y N 185 PHE CD1 HD1 sing N N 186 PHE CD2 CE2 doub Y N 187 PHE CD2 HD2 sing N N 188 PHE CE1 CZ doub Y N 189 PHE CE1 HE1 sing N N 190 PHE CE2 CZ sing Y N 191 PHE CE2 HE2 sing N N 192 PHE CZ HZ sing N N 193 PHE OXT HXT sing N N 194 SER N CA sing N N 195 SER N H sing N N 196 SER N H2 sing N N 197 SER CA C sing N N 198 SER CA CB sing N N 199 SER CA HA sing N N 200 SER C O doub N N 201 SER C OXT sing N N 202 SER CB OG sing N N 203 SER CB HB2 sing N N 204 SER CB HB3 sing N N 205 SER OG HG sing N N 206 SER OXT HXT sing N N 207 THR N CA sing N N 208 THR N H sing N N 209 THR N H2 sing N N 210 THR CA C sing N N 211 THR CA CB sing N N 212 THR CA HA sing N N 213 THR C O doub N N 214 THR C OXT sing N N 215 THR CB OG1 sing N N 216 THR CB CG2 sing N N 217 THR CB HB sing N N 218 THR OG1 HG1 sing N N 219 THR CG2 HG21 sing N N 220 THR CG2 HG22 sing N N 221 THR CG2 HG23 sing N N 222 THR OXT HXT sing N N 223 TRP N CA sing N N 224 TRP N H sing N N 225 TRP N H2 sing N N 226 TRP CA C sing N N 227 TRP CA CB sing N N 228 TRP CA HA sing N N 229 TRP C O doub N N 230 TRP C OXT sing N N 231 TRP CB CG sing N N 232 TRP CB HB2 sing N N 233 TRP CB HB3 sing N N 234 TRP CG CD1 doub Y N 235 TRP CG CD2 sing Y N 236 TRP CD1 NE1 sing Y N 237 TRP CD1 HD1 sing N N 238 TRP CD2 CE2 doub Y N 239 TRP CD2 CE3 sing Y N 240 TRP NE1 CE2 sing Y N 241 TRP NE1 HE1 sing N N 242 TRP CE2 CZ2 sing Y N 243 TRP CE3 CZ3 doub Y N 244 TRP CE3 HE3 sing N N 245 TRP CZ2 CH2 doub Y N 246 TRP CZ2 HZ2 sing N N 247 TRP CZ3 CH2 sing Y N 248 TRP CZ3 HZ3 sing N N 249 TRP CH2 HH2 sing N N 250 TRP OXT HXT sing N N 251 TYR N CA sing N N 252 TYR N H sing N N 253 TYR N H2 sing N N 254 TYR CA C sing N N 255 TYR CA CB sing N N 256 TYR CA HA sing N N 257 TYR C O doub N N 258 TYR C OXT sing N N 259 TYR CB CG sing N N 260 TYR CB HB2 sing N N 261 TYR CB HB3 sing N N 262 TYR CG CD1 doub Y N 263 TYR CG CD2 sing Y N 264 TYR CD1 CE1 sing Y N 265 TYR CD1 HD1 sing N N 266 TYR CD2 CE2 doub Y N 267 TYR CD2 HD2 sing N N 268 TYR CE1 CZ doub Y N 269 TYR CE1 HE1 sing N N 270 TYR CE2 CZ sing Y N 271 TYR CE2 HE2 sing N N 272 TYR CZ OH sing N N 273 TYR OH HH sing N N 274 TYR OXT HXT sing N N 275 VAL N CA sing N N 276 VAL N H sing N N 277 VAL N H2 sing N N 278 VAL CA C sing N N 279 VAL CA CB sing N N 280 VAL CA HA sing N N 281 VAL C O doub N N 282 VAL C OXT sing N N 283 VAL CB CG1 sing N N 284 VAL CB CG2 sing N N 285 VAL CB HB sing N N 286 VAL CG1 HG11 sing N N 287 VAL CG1 HG12 sing N N 288 VAL CG1 HG13 sing N N 289 VAL CG2 HG21 sing N N 290 VAL CG2 HG22 sing N N 291 VAL CG2 HG23 sing N N 292 VAL OXT HXT sing N N 293 # _atom_sites.entry_id 1SRB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #