data_1SRZ # _entry.id 1SRZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SRZ pdb_00001srz 10.2210/pdb1srz/pdb RCSB RCSB021950 ? ? WWPDB D_1000021950 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-10-12 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SRZ _pdbx_database_status.recvd_initial_deposition_date 2004-03-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Blein, S.' 1 'Uhrin, D.' 2 'Smith, B.O.' 3 'White, J.H.' 4 'Barlow, P.N.' 5 # _citation.id primary _citation.title ;Structural Analysis of the Complement Control Protein (CCP) Modules of GABAB Receptor 1a: ONLY ONE OF THE TWO CCP MODULES IS COMPACTLY FOLDED ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 279 _citation.page_first 48292 _citation.page_last 48306 _citation.year 2004 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15304491 _citation.pdbx_database_id_DOI 10.1074/jbc.M406540200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Blein, S.' 1 ? primary 'Ginham, R.' 2 ? primary 'Uhrin, D.' 3 ? primary 'Smith, B.O.' 4 ? primary 'Soares, D.C.' 5 ? primary 'Veltel, S.' 6 ? primary 'McIlhinney, R.A.' 7 ? primary 'White, J.H.' 8 ? primary 'Barlow, P.N.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Gamma-aminobutyric acid type B receptor, subunit 1' _entity.formula_weight 7494.419 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Residues 96-159' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GABA-B receptor 1, GABA-B-R1, Gb1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EAEFVRICSKSYLTLENGKVFLTGGDLPALDGARVEFRCDPDFHLVGSSRSVCSQGQWSTPKPHCQVN _entity_poly.pdbx_seq_one_letter_code_can EAEFVRICSKSYLTLENGKVFLTGGDLPALDGARVEFRCDPDFHLVGSSRSVCSQGQWSTPKPHCQVN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ALA n 1 3 GLU n 1 4 PHE n 1 5 VAL n 1 6 ARG n 1 7 ILE n 1 8 CYS n 1 9 SER n 1 10 LYS n 1 11 SER n 1 12 TYR n 1 13 LEU n 1 14 THR n 1 15 LEU n 1 16 GLU n 1 17 ASN n 1 18 GLY n 1 19 LYS n 1 20 VAL n 1 21 PHE n 1 22 LEU n 1 23 THR n 1 24 GLY n 1 25 GLY n 1 26 ASP n 1 27 LEU n 1 28 PRO n 1 29 ALA n 1 30 LEU n 1 31 ASP n 1 32 GLY n 1 33 ALA n 1 34 ARG n 1 35 VAL n 1 36 GLU n 1 37 PHE n 1 38 ARG n 1 39 CYS n 1 40 ASP n 1 41 PRO n 1 42 ASP n 1 43 PHE n 1 44 HIS n 1 45 LEU n 1 46 VAL n 1 47 GLY n 1 48 SER n 1 49 SER n 1 50 ARG n 1 51 SER n 1 52 VAL n 1 53 CYS n 1 54 SER n 1 55 GLN n 1 56 GLY n 1 57 GLN n 1 58 TRP n 1 59 SER n 1 60 THR n 1 61 PRO n 1 62 LYS n 1 63 PRO n 1 64 HIS n 1 65 CYS n 1 66 GLN n 1 67 VAL n 1 68 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene GABBR1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus Pichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain KM71 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPICZalpha _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 92 92 GLU GLU A . n A 1 2 ALA 2 93 93 ALA ALA A . n A 1 3 GLU 3 94 94 GLU GLU A . n A 1 4 PHE 4 95 95 PHE PHE A . n A 1 5 VAL 5 96 96 VAL VAL A . n A 1 6 ARG 6 97 97 ARG ARG A . n A 1 7 ILE 7 98 98 ILE ILE A . n A 1 8 CYS 8 99 99 CYS CYS A . n A 1 9 SER 9 100 100 SER SER A . n A 1 10 LYS 10 101 101 LYS LYS A . n A 1 11 SER 11 102 102 SER SER A . n A 1 12 TYR 12 103 103 TYR TYR A . n A 1 13 LEU 13 104 104 LEU LEU A . n A 1 14 THR 14 105 105 THR THR A . n A 1 15 LEU 15 106 106 LEU LEU A . n A 1 16 GLU 16 107 107 GLU GLU A . n A 1 17 ASN 17 108 108 ASN ASN A . n A 1 18 GLY 18 109 109 GLY GLY A . n A 1 19 LYS 19 110 110 LYS LYS A . n A 1 20 VAL 20 111 111 VAL VAL A . n A 1 21 PHE 21 112 112 PHE PHE A . n A 1 22 LEU 22 113 113 LEU LEU A . n A 1 23 THR 23 114 114 THR THR A . n A 1 24 GLY 24 115 115 GLY GLY A . n A 1 25 GLY 25 116 116 GLY GLY A . n A 1 26 ASP 26 117 117 ASP ASP A . n A 1 27 LEU 27 118 118 LEU LEU A . n A 1 28 PRO 28 119 119 PRO PRO A . n A 1 29 ALA 29 120 120 ALA ALA A . n A 1 30 LEU 30 121 121 LEU LEU A . n A 1 31 ASP 31 122 122 ASP ASP A . n A 1 32 GLY 32 123 123 GLY GLY A . n A 1 33 ALA 33 124 124 ALA ALA A . n A 1 34 ARG 34 125 125 ARG ARG A . n A 1 35 VAL 35 126 126 VAL VAL A . n A 1 36 GLU 36 127 127 GLU GLU A . n A 1 37 PHE 37 128 128 PHE PHE A . n A 1 38 ARG 38 129 129 ARG ARG A . n A 1 39 CYS 39 130 130 CYS CYS A . n A 1 40 ASP 40 131 131 ASP ASP A . n A 1 41 PRO 41 132 132 PRO PRO A . n A 1 42 ASP 42 133 133 ASP ASP A . n A 1 43 PHE 43 134 134 PHE PHE A . n A 1 44 HIS 44 135 135 HIS HIS A . n A 1 45 LEU 45 136 136 LEU LEU A . n A 1 46 VAL 46 137 137 VAL VAL A . n A 1 47 GLY 47 138 138 GLY GLY A . n A 1 48 SER 48 139 139 SER SER A . n A 1 49 SER 49 140 140 SER SER A . n A 1 50 ARG 50 141 141 ARG ARG A . n A 1 51 SER 51 142 142 SER SER A . n A 1 52 VAL 52 143 143 VAL VAL A . n A 1 53 CYS 53 144 144 CYS CYS A . n A 1 54 SER 54 145 145 SER SER A . n A 1 55 GLN 55 146 146 GLN GLN A . n A 1 56 GLY 56 147 147 GLY GLY A . n A 1 57 GLN 57 148 148 GLN GLN A . n A 1 58 TRP 58 149 149 TRP TRP A . n A 1 59 SER 59 150 150 SER SER A . n A 1 60 THR 60 151 151 THR THR A . n A 1 61 PRO 61 152 152 PRO PRO A . n A 1 62 LYS 62 153 153 LYS LYS A . n A 1 63 PRO 63 154 154 PRO PRO A . n A 1 64 HIS 64 155 155 HIS HIS A . n A 1 65 CYS 65 156 156 CYS CYS A . n A 1 66 GLN 66 157 157 GLN GLN A . n A 1 67 VAL 67 158 158 VAL VAL A . n A 1 68 ASN 68 159 159 ASN ASN A . n # _exptl.entry_id 1SRZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1SRZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1SRZ _struct.title 'Solution structure of the second complement control protein (CCP) module of the GABA(B)R1a receptor, Pro-119 trans conformer' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SRZ _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'GABA(B) receptor, cis-trans isomerization, CCP module, sushi domain, short consensus repeat, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GABR1_RAT _struct_ref.pdbx_db_accession Q9Z0U4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VRICSKSYLTLENGKVFLTGGDLPALDGARVEFRCDPDFHLVGSSRSVCSQGQWSTPKPHCQVN _struct_ref.pdbx_align_begin 96 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SRZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Z0U4 _struct_ref_seq.db_align_beg 96 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 159 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 96 _struct_ref_seq.pdbx_auth_seq_align_end 159 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1SRZ GLU A 1 ? UNP Q9Z0U4 ? ? 'cloning artifact' 92 1 1 1SRZ ALA A 2 ? UNP Q9Z0U4 ? ? 'cloning artifact' 93 2 1 1SRZ GLU A 3 ? UNP Q9Z0U4 ? ? 'cloning artifact' 94 3 1 1SRZ PHE A 4 ? UNP Q9Z0U4 ? ? 'cloning artifact' 95 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 9 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 12 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 100 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 103 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 99 A CYS 144 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 130 A CYS 156 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 8 ? CYS A 53 ? CYS A 99 ? 1_555 CYS A 144 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 39 ? CYS A 65 ? CYS A 130 ? 1_555 CYS A 156 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 14 ? LEU A 15 ? THR A 105 LEU A 106 A 2 GLY A 18 ? PHE A 21 ? GLY A 109 PHE A 112 A 3 ARG A 34 ? CYS A 39 ? ARG A 125 CYS A 130 A 4 ARG A 50 ? SER A 54 ? ARG A 141 SER A 145 A 5 GLN A 57 ? TRP A 58 ? GLN A 148 TRP A 149 B 1 PHE A 43 ? LEU A 45 ? PHE A 134 LEU A 136 B 2 CYS A 65 ? VAL A 67 ? CYS A 156 VAL A 158 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 15 ? N LEU A 106 O GLY A 18 ? O GLY A 109 A 2 3 N LYS A 19 ? N LYS A 110 O ARG A 38 ? O ARG A 129 A 3 4 N VAL A 35 ? N VAL A 126 O SER A 51 ? O SER A 142 A 4 5 N SER A 54 ? N SER A 145 O GLN A 57 ? O GLN A 148 B 1 2 N HIS A 44 ? N HIS A 135 O GLN A 66 ? O GLN A 157 # _pdbx_entry_details.entry_id 1SRZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 11 HA A ILE 98 ? ? HB2 A LEU 121 ? ? 1.28 2 12 HG3 A ARG 97 ? ? HG13 A ILE 98 ? ? 1.35 3 16 HG2 A ARG 97 ? ? H A ILE 98 ? ? 1.29 4 21 HA3 A GLY 115 ? ? HB2 A ALA 124 ? ? 1.35 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 93 ? ? 55.75 -139.78 2 1 GLU A 94 ? ? -173.80 133.72 3 1 PHE A 95 ? ? 57.72 -129.03 4 1 ARG A 97 ? ? -80.70 47.60 5 1 SER A 100 ? ? -38.25 113.53 6 1 THR A 114 ? ? -158.53 69.47 7 1 ASP A 117 ? ? -144.76 52.00 8 1 ALA A 120 ? ? 70.77 -33.55 9 1 PRO A 132 ? ? -67.63 57.30 10 1 ASP A 133 ? ? -158.06 -43.30 11 1 SER A 140 ? ? -57.61 -7.02 12 1 PRO A 154 ? ? -85.40 -151.88 13 2 ALA A 93 ? ? -64.09 -141.56 14 2 VAL A 96 ? ? -174.89 139.12 15 2 ARG A 97 ? ? -169.28 61.05 16 2 THR A 105 ? ? 61.84 132.17 17 2 THR A 114 ? ? -162.16 66.43 18 2 PRO A 132 ? ? -54.48 77.89 19 2 ASP A 133 ? ? 179.02 -41.68 20 2 PRO A 154 ? ? -72.89 -143.85 21 3 GLU A 94 ? ? -173.22 -139.91 22 3 PHE A 95 ? ? -170.93 -134.09 23 3 ARG A 97 ? ? -88.82 -158.47 24 3 ILE A 98 ? ? 64.74 143.79 25 3 SER A 100 ? ? -39.78 131.80 26 3 SER A 102 ? ? -164.13 -34.90 27 3 THR A 114 ? ? -155.75 63.44 28 3 ASP A 117 ? ? -150.27 46.79 29 3 ALA A 120 ? ? 72.77 -40.74 30 3 ARG A 129 ? ? -167.22 118.82 31 3 PRO A 132 ? ? -47.49 162.81 32 3 ASP A 133 ? ? 77.93 -35.07 33 3 SER A 145 ? ? -173.25 137.53 34 3 PRO A 152 ? ? -64.86 -162.01 35 3 PRO A 154 ? ? -81.75 -149.22 36 4 ALA A 93 ? ? -172.00 -47.15 37 4 PHE A 95 ? ? -78.33 44.81 38 4 ARG A 97 ? ? -85.51 -148.67 39 4 ILE A 98 ? ? 52.75 137.06 40 4 SER A 102 ? ? -166.24 -36.20 41 4 THR A 114 ? ? -158.49 62.65 42 4 ASP A 117 ? ? 73.31 41.98 43 4 PHE A 128 ? ? -86.86 44.11 44 4 PRO A 132 ? ? -47.66 162.94 45 4 ASP A 133 ? ? 78.31 -31.40 46 4 SER A 145 ? ? -171.31 27.21 47 4 GLN A 146 ? ? -176.26 37.94 48 4 PRO A 154 ? ? -89.26 -151.67 49 5 ALA A 93 ? ? -174.62 -46.49 50 5 SER A 100 ? ? -39.89 111.18 51 5 TYR A 103 ? ? -76.23 45.28 52 5 LEU A 104 ? ? -132.82 -37.20 53 5 GLU A 107 ? ? -82.83 45.15 54 5 ASN A 108 ? ? 179.55 36.03 55 5 THR A 114 ? ? -157.46 61.33 56 5 PRO A 119 ? ? -54.73 82.12 57 5 ASP A 122 ? ? -77.00 46.02 58 5 PRO A 132 ? ? -62.80 73.63 59 5 ASP A 133 ? ? -176.31 -42.91 60 5 PRO A 152 ? ? -64.90 -158.43 61 5 PRO A 154 ? ? -75.26 -156.49 62 6 GLU A 94 ? ? -175.88 54.76 63 6 ILE A 98 ? ? -171.75 32.65 64 6 CYS A 99 ? ? 59.38 150.51 65 6 SER A 100 ? ? -39.86 125.55 66 6 SER A 102 ? ? -69.00 40.30 67 6 THR A 114 ? ? -155.62 55.18 68 6 ASP A 117 ? ? 77.23 41.21 69 6 PRO A 119 ? ? -55.47 81.16 70 6 ALA A 120 ? ? 73.69 -38.07 71 6 LEU A 121 ? ? 55.20 80.85 72 6 ASP A 122 ? ? -75.02 48.69 73 6 PRO A 132 ? ? -45.64 162.02 74 6 ASP A 133 ? ? 77.83 -36.57 75 6 SER A 145 ? ? -157.45 -23.89 76 6 GLN A 146 ? ? -159.20 58.16 77 6 PRO A 152 ? ? -59.25 -147.87 78 6 PRO A 154 ? ? -76.68 -155.68 79 7 ALA A 93 ? ? -176.92 45.56 80 7 ARG A 97 ? ? -167.20 58.42 81 7 SER A 100 ? ? -37.93 113.36 82 7 LYS A 101 ? ? -69.43 1.95 83 7 THR A 105 ? ? 60.52 130.84 84 7 THR A 114 ? ? -158.88 56.16 85 7 ASP A 117 ? ? -151.40 53.03 86 7 ALA A 120 ? ? 72.66 -38.99 87 7 ALA A 124 ? ? -49.92 152.27 88 7 PRO A 132 ? ? -58.03 76.50 89 7 ASP A 133 ? ? -178.68 -40.49 90 7 PRO A 154 ? ? -79.20 -154.79 91 8 PHE A 95 ? ? -173.87 135.53 92 8 ILE A 98 ? ? 175.21 144.35 93 8 SER A 100 ? ? -39.86 128.45 94 8 LEU A 104 ? ? -77.88 40.01 95 8 GLU A 107 ? ? -90.58 41.00 96 8 ASN A 108 ? ? -160.12 27.84 97 8 THR A 114 ? ? -157.95 54.40 98 8 ASP A 117 ? ? -167.32 67.17 99 8 PRO A 119 ? ? -38.18 97.16 100 8 ALA A 120 ? ? 70.68 -20.05 101 8 PRO A 132 ? ? -58.37 78.73 102 8 ASP A 133 ? ? -177.46 -37.03 103 8 SER A 145 ? ? -168.14 35.78 104 8 GLN A 146 ? ? 175.80 39.91 105 8 PRO A 154 ? ? -75.25 -150.68 106 9 ALA A 93 ? ? -176.82 -43.12 107 9 VAL A 96 ? ? 177.77 141.32 108 9 ARG A 97 ? ? -168.66 109.51 109 9 ILE A 98 ? ? -175.87 135.72 110 9 TYR A 103 ? ? -64.59 -70.57 111 9 LEU A 104 ? ? -46.98 156.97 112 9 THR A 105 ? ? 64.67 73.13 113 9 THR A 114 ? ? -161.88 54.42 114 9 ASP A 117 ? ? -164.08 54.70 115 9 PRO A 119 ? ? -47.52 83.37 116 9 ASP A 122 ? ? -76.79 44.93 117 9 PRO A 132 ? ? -36.82 137.00 118 9 SER A 139 ? ? -65.66 65.80 119 9 SER A 145 ? ? -152.43 -23.01 120 9 GLN A 146 ? ? -146.58 46.18 121 9 PRO A 154 ? ? -85.03 -140.25 122 10 ALA A 93 ? ? -174.37 45.94 123 10 ARG A 97 ? ? -171.82 -161.89 124 10 ILE A 98 ? ? 64.44 129.60 125 10 SER A 100 ? ? -39.44 104.02 126 10 LYS A 101 ? ? -66.46 3.95 127 10 GLU A 107 ? ? -80.92 42.24 128 10 ASN A 108 ? ? -154.08 -31.31 129 10 THR A 114 ? ? -157.47 42.93 130 10 ASP A 117 ? ? -173.13 33.72 131 10 ALA A 120 ? ? 71.18 -38.03 132 10 ASP A 122 ? ? -76.54 48.97 133 10 PRO A 132 ? ? -52.69 77.60 134 10 ASP A 133 ? ? -179.44 -41.80 135 10 PRO A 154 ? ? -72.39 -152.15 136 11 ALA A 93 ? ? 64.57 134.19 137 11 PHE A 95 ? ? -70.14 -145.18 138 11 ARG A 97 ? ? -66.79 -156.08 139 11 ILE A 98 ? ? 67.19 127.01 140 11 SER A 100 ? ? -40.68 105.07 141 11 LYS A 101 ? ? -69.13 15.38 142 11 THR A 114 ? ? -162.37 52.40 143 11 ASP A 117 ? ? -174.50 36.43 144 11 PRO A 132 ? ? -40.89 152.90 145 11 ASP A 133 ? ? 78.03 -34.38 146 11 SER A 145 ? ? -163.15 26.66 147 11 GLN A 146 ? ? 175.86 39.51 148 11 PRO A 154 ? ? -75.91 -150.85 149 12 ALA A 93 ? ? -178.21 46.15 150 12 ARG A 97 ? ? -172.20 -164.63 151 12 CYS A 99 ? ? 58.77 149.90 152 12 SER A 100 ? ? -40.41 100.84 153 12 THR A 114 ? ? -158.10 56.11 154 12 ASP A 117 ? ? -165.80 58.38 155 12 ALA A 120 ? ? 72.99 -40.24 156 12 PRO A 132 ? ? -46.28 159.21 157 12 ASP A 133 ? ? 78.27 -37.53 158 12 SER A 145 ? ? -172.21 -30.85 159 12 GLN A 146 ? ? -150.80 49.50 160 12 PRO A 152 ? ? -63.83 -152.66 161 12 PRO A 154 ? ? -85.45 -146.91 162 12 HIS A 155 ? ? -153.72 -149.28 163 13 ALA A 93 ? ? -173.52 -135.28 164 13 PHE A 95 ? ? 63.93 138.03 165 13 VAL A 96 ? ? -172.03 134.90 166 13 ARG A 97 ? ? -65.84 -152.87 167 13 ILE A 98 ? ? 52.63 127.13 168 13 SER A 100 ? ? -39.89 130.31 169 13 THR A 105 ? ? 62.66 137.80 170 13 THR A 114 ? ? -163.58 97.66 171 13 ASP A 117 ? ? 72.23 37.11 172 13 PRO A 119 ? ? -50.86 97.78 173 13 ALA A 120 ? ? 55.64 17.06 174 13 ASP A 122 ? ? -75.53 46.02 175 13 PRO A 132 ? ? -57.36 75.46 176 13 ASP A 133 ? ? 179.93 -40.27 177 13 PRO A 154 ? ? -76.78 -154.90 178 14 ALA A 93 ? ? -173.15 -141.25 179 14 ARG A 97 ? ? -165.59 62.71 180 14 SER A 100 ? ? -39.88 128.56 181 14 GLU A 107 ? ? -82.64 30.05 182 14 ASN A 108 ? ? -166.14 25.68 183 14 THR A 114 ? ? -163.28 61.17 184 14 ASP A 117 ? ? -147.47 48.30 185 14 PRO A 119 ? ? -43.82 94.77 186 14 ALA A 120 ? ? 69.25 -9.03 187 14 ASP A 122 ? ? -75.12 49.63 188 14 PRO A 132 ? ? -57.28 75.07 189 14 ASP A 133 ? ? 178.89 -36.03 190 14 SER A 139 ? ? -68.86 63.63 191 14 SER A 145 ? ? -104.65 -123.72 192 14 PRO A 154 ? ? -79.48 -149.60 193 15 GLU A 94 ? ? -174.24 135.69 194 15 PHE A 95 ? ? -172.65 131.56 195 15 ARG A 97 ? ? -167.29 110.19 196 15 GLU A 107 ? ? -81.84 34.99 197 15 ASN A 108 ? ? -160.75 -49.17 198 15 LYS A 110 ? ? -142.04 -42.33 199 15 VAL A 111 ? ? 48.55 115.60 200 15 THR A 114 ? ? -157.11 53.97 201 15 ASP A 117 ? ? 73.87 53.38 202 15 ALA A 120 ? ? 56.55 18.27 203 15 PRO A 132 ? ? -45.04 152.44 204 15 ASP A 133 ? ? 79.62 -29.57 205 15 PRO A 154 ? ? -75.69 -148.94 206 16 ALA A 93 ? ? -177.91 49.65 207 16 GLU A 94 ? ? -170.88 138.46 208 16 ARG A 97 ? ? -175.97 -155.98 209 16 LYS A 101 ? ? -74.46 23.22 210 16 LEU A 104 ? ? -68.86 23.90 211 16 GLU A 107 ? ? -82.36 46.15 212 16 ASN A 108 ? ? -158.89 -30.24 213 16 ASP A 117 ? ? 71.86 49.84 214 16 PRO A 119 ? ? -74.55 33.94 215 16 ALA A 120 ? ? 172.19 -44.84 216 16 ALA A 124 ? ? -48.83 153.53 217 16 PRO A 132 ? ? -43.04 159.99 218 16 ASP A 133 ? ? 80.76 -31.88 219 16 SER A 145 ? ? -175.04 132.95 220 16 PRO A 154 ? ? -79.26 -149.64 221 17 VAL A 96 ? ? -172.38 129.42 222 17 ARG A 97 ? ? -68.68 -176.31 223 17 ILE A 98 ? ? 68.94 135.45 224 17 SER A 100 ? ? -35.85 120.98 225 17 THR A 114 ? ? -156.59 56.80 226 17 ASP A 117 ? ? -152.15 41.84 227 17 ALA A 120 ? ? 73.63 -37.44 228 17 PRO A 132 ? ? -45.08 155.38 229 17 ASP A 133 ? ? 78.57 -34.72 230 17 PRO A 154 ? ? -84.37 -148.01 231 18 GLU A 94 ? ? -174.83 -50.35 232 18 ARG A 97 ? ? 44.01 -147.61 233 18 CYS A 99 ? ? 55.97 142.03 234 18 THR A 114 ? ? -158.86 53.31 235 18 ASP A 117 ? ? 73.20 42.21 236 18 PRO A 119 ? ? -44.87 89.83 237 18 ALA A 120 ? ? 56.00 13.58 238 18 ASP A 122 ? ? -76.11 45.07 239 18 ASP A 133 ? ? 80.64 -31.37 240 18 SER A 145 ? ? -169.65 31.56 241 18 GLN A 146 ? ? 177.47 34.06 242 18 PRO A 154 ? ? -69.71 -160.91 243 19 ALA A 93 ? ? -171.30 39.97 244 19 ILE A 98 ? ? -162.27 42.53 245 19 CYS A 99 ? ? 64.27 133.00 246 19 THR A 114 ? ? -153.33 53.73 247 19 ASP A 117 ? ? -171.29 39.58 248 19 PRO A 119 ? ? -48.41 81.15 249 19 ALA A 120 ? ? 75.20 -40.81 250 19 ASP A 122 ? ? -57.35 84.50 251 19 ALA A 124 ? ? -49.81 150.67 252 19 PRO A 132 ? ? -66.55 62.97 253 19 ASP A 133 ? ? -177.12 -29.39 254 19 SER A 145 ? ? -173.02 120.01 255 19 PRO A 152 ? ? -67.08 -160.52 256 19 PRO A 154 ? ? -81.10 -151.79 257 20 GLU A 94 ? ? -81.53 47.29 258 20 GLU A 107 ? ? -81.40 38.52 259 20 ASN A 108 ? ? 177.21 26.63 260 20 PRO A 119 ? ? -52.50 85.95 261 20 ASP A 122 ? ? -76.43 45.59 262 20 ASP A 133 ? ? -153.07 -37.45 263 20 PRO A 154 ? ? -73.21 -152.15 264 21 PHE A 95 ? ? 64.42 132.40 265 21 ARG A 97 ? ? -65.41 -155.65 266 21 ILE A 98 ? ? 51.81 134.57 267 21 LEU A 104 ? ? -74.71 38.95 268 21 GLU A 107 ? ? -82.58 43.13 269 21 ASN A 108 ? ? -177.02 -43.32 270 21 LYS A 110 ? ? -142.12 -43.81 271 21 VAL A 111 ? ? 49.10 120.00 272 21 THR A 114 ? ? -158.51 53.06 273 21 PRO A 119 ? ? -46.18 96.37 274 21 ALA A 120 ? ? 68.62 -29.83 275 21 PRO A 132 ? ? -59.31 72.92 276 21 ASP A 133 ? ? 178.66 -39.07 277 21 SER A 145 ? ? -172.68 134.01 278 21 PRO A 152 ? ? -62.03 -159.37 279 21 PRO A 154 ? ? -74.36 -148.66 280 22 GLU A 94 ? ? -168.15 -40.00 281 22 THR A 105 ? ? 65.35 137.72 282 22 THR A 114 ? ? -158.89 65.61 283 22 PRO A 119 ? ? -43.57 80.24 284 22 ASP A 122 ? ? -74.97 42.38 285 22 PHE A 128 ? ? -84.38 47.30 286 22 PRO A 132 ? ? -55.18 79.67 287 22 ASP A 133 ? ? -179.14 -40.43 288 22 PRO A 154 ? ? -81.32 -147.70 289 23 ALA A 93 ? ? -170.72 131.30 290 23 GLU A 94 ? ? -173.42 -129.94 291 23 PHE A 95 ? ? -177.76 132.52 292 23 ARG A 97 ? ? -163.64 49.96 293 23 ILE A 98 ? ? -158.82 41.80 294 23 CYS A 99 ? ? 62.31 134.02 295 23 LEU A 104 ? ? -76.98 33.30 296 23 THR A 105 ? ? -147.54 58.54 297 23 THR A 114 ? ? -152.96 65.96 298 23 ASP A 117 ? ? -148.68 47.84 299 23 PRO A 119 ? ? -43.47 105.16 300 23 ALA A 120 ? ? 72.45 -37.95 301 23 ALA A 124 ? ? -49.05 153.04 302 23 PRO A 132 ? ? -69.73 52.07 303 23 ASP A 133 ? ? -155.59 -39.35 304 23 SER A 139 ? ? -68.75 65.41 305 23 SER A 145 ? ? -170.57 131.41 306 23 PRO A 154 ? ? -71.49 -146.78 307 24 ALA A 93 ? ? 63.66 127.76 308 24 GLU A 94 ? ? -83.45 40.90 309 24 PHE A 95 ? ? -82.58 45.36 310 24 VAL A 96 ? ? 65.19 139.95 311 24 ARG A 97 ? ? -172.44 121.58 312 24 ILE A 98 ? ? -173.45 39.03 313 24 CYS A 99 ? ? 61.18 160.45 314 24 SER A 100 ? ? -39.82 128.67 315 24 THR A 114 ? ? -156.19 62.17 316 24 ASP A 117 ? ? -159.27 48.19 317 24 PRO A 119 ? ? -39.63 106.10 318 24 ALA A 120 ? ? 72.54 -32.29 319 24 PRO A 132 ? ? -59.90 75.31 320 24 ASP A 133 ? ? -174.63 -40.83 321 24 SER A 145 ? ? -173.28 113.64 322 24 PRO A 154 ? ? -72.37 -152.48 # _pdbx_nmr_ensemble.entry_id 1SRZ _pdbx_nmr_ensemble.conformers_calculated_total_number 120 _pdbx_nmr_ensemble.conformers_submitted_total_number 24 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1SRZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM GABA(B)R1a 2nd CCP module U-15N,13C, 20 mM deuterated sodium acetate buffer, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HNHA # _pdbx_nmr_refine.entry_id 1SRZ _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics' _pdbx_nmr_refine.details '1363 unique restraints, 20 dihedral angle restraints (HNHA), 11 hydrogen bonds' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1 collection ? 1 Azara 2.6 processing ? 2 ANSIG 3.3 'data analysis' ? 3 CNS 1.0 'structure solution' ? 4 CNS 1.0 refinement ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Bruker DRX 800 # _atom_sites.entry_id 1SRZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #