data_1SSK # _entry.id 1SSK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SSK pdb_00001ssk 10.2210/pdb1ssk/pdb RCSB RCSB021967 ? ? WWPDB D_1000021967 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SSK _pdbx_database_status.recvd_initial_deposition_date 2004-03-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huang, Q.' 1 'Yu, L.' 2 'Petros, A.M.' 3 'Gunasekera, A.' 4 'Liu, Z.' 5 'Xu, N.' 6 'Hajduk, P.' 7 'Mack, J.' 8 'Fesik, S.W.' 9 'Olejniczak, E.T.' 10 # _citation.id primary _citation.title 'Structure of the N-Terminal RNA-Binding Domain of the SARS CoV Nucleocapsid Protein.' _citation.journal_abbrev Biochemistry _citation.journal_volume 43 _citation.page_first 6059 _citation.page_last 6063 _citation.year 2004 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15147189 _citation.pdbx_database_id_DOI 10.1021/bi036155b # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, Q.' 1 ? primary 'Yu, L.' 2 ? primary 'Petros, A.M.' 3 ? primary 'Gunasekera, A.' 4 ? primary 'Liu, Z.' 5 ? primary 'Xu, N.' 6 ? primary 'Hajduk, P.' 7 ? primary 'Mack, J.' 8 ? primary 'Fesik, S.W.' 9 ? primary 'Olejniczak, E.T.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Nucleocapsid protein' _entity.formula_weight 17179.035 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal Domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'N structural protein, NC' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSAMGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMK ELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSAMGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMK ELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 ALA n 1 21 MET n 1 22 GLY n 1 23 LEU n 1 24 PRO n 1 25 ASN n 1 26 ASN n 1 27 THR n 1 28 ALA n 1 29 SER n 1 30 TRP n 1 31 PHE n 1 32 THR n 1 33 ALA n 1 34 LEU n 1 35 THR n 1 36 GLN n 1 37 HIS n 1 38 GLY n 1 39 LYS n 1 40 GLU n 1 41 GLU n 1 42 LEU n 1 43 ARG n 1 44 PHE n 1 45 PRO n 1 46 ARG n 1 47 GLY n 1 48 GLN n 1 49 GLY n 1 50 VAL n 1 51 PRO n 1 52 ILE n 1 53 ASN n 1 54 THR n 1 55 ASN n 1 56 SER n 1 57 GLY n 1 58 PRO n 1 59 ASP n 1 60 ASP n 1 61 GLN n 1 62 ILE n 1 63 GLY n 1 64 TYR n 1 65 TYR n 1 66 ARG n 1 67 ARG n 1 68 ALA n 1 69 THR n 1 70 ARG n 1 71 ARG n 1 72 VAL n 1 73 ARG n 1 74 GLY n 1 75 GLY n 1 76 ASP n 1 77 GLY n 1 78 LYS n 1 79 MET n 1 80 LYS n 1 81 GLU n 1 82 LEU n 1 83 SER n 1 84 PRO n 1 85 ARG n 1 86 TRP n 1 87 TYR n 1 88 PHE n 1 89 TYR n 1 90 TYR n 1 91 LEU n 1 92 GLY n 1 93 THR n 1 94 GLY n 1 95 PRO n 1 96 GLU n 1 97 ALA n 1 98 SER n 1 99 LEU n 1 100 PRO n 1 101 TYR n 1 102 GLY n 1 103 ALA n 1 104 ASN n 1 105 LYS n 1 106 GLU n 1 107 GLY n 1 108 ILE n 1 109 VAL n 1 110 TRP n 1 111 VAL n 1 112 ALA n 1 113 THR n 1 114 GLU n 1 115 GLY n 1 116 ALA n 1 117 LEU n 1 118 ASN n 1 119 THR n 1 120 PRO n 1 121 LYS n 1 122 ASP n 1 123 HIS n 1 124 ILE n 1 125 GLY n 1 126 THR n 1 127 ARG n 1 128 ASN n 1 129 PRO n 1 130 ASN n 1 131 ASN n 1 132 ASN n 1 133 ALA n 1 134 ALA n 1 135 THR n 1 136 VAL n 1 137 LEU n 1 138 GLN n 1 139 LEU n 1 140 PRO n 1 141 GLN n 1 142 GLY n 1 143 THR n 1 144 THR n 1 145 LEU n 1 146 PRO n 1 147 LYS n 1 148 GLY n 1 149 PHE n 1 150 TYR n 1 151 ALA n 1 152 GLU n 1 153 GLY n 1 154 SER n 1 155 ARG n 1 156 GLY n 1 157 GLY n 1 158 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Coronavirus _entity_src_gen.pdbx_gene_src_gene N _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain SARS _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'SARS coronavirus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 227859 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet21d+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NCAP_CVHSA _struct_ref.pdbx_db_accession P59595 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPY GANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGS ; _struct_ref.pdbx_align_begin 45 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SSK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 158 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P59595 _struct_ref_seq.db_align_beg 45 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 181 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 22 _struct_ref_seq.pdbx_auth_seq_align_end 158 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1SSK MET A 1 ? UNP P59595 ? ? 'cloning artifact' 1 1 1 1SSK GLY A 2 ? UNP P59595 ? ? 'cloning artifact' 2 2 1 1SSK SER A 3 ? UNP P59595 ? ? 'cloning artifact' 3 3 1 1SSK SER A 4 ? UNP P59595 ? ? 'cloning artifact' 4 4 1 1SSK HIS A 5 ? UNP P59595 ? ? 'expression tag' 5 5 1 1SSK HIS A 6 ? UNP P59595 ? ? 'expression tag' 6 6 1 1SSK HIS A 7 ? UNP P59595 ? ? 'expression tag' 7 7 1 1SSK HIS A 8 ? UNP P59595 ? ? 'expression tag' 8 8 1 1SSK HIS A 9 ? UNP P59595 ? ? 'expression tag' 9 9 1 1SSK HIS A 10 ? UNP P59595 ? ? 'expression tag' 10 10 1 1SSK SER A 11 ? UNP P59595 ? ? 'cloning artifact' 11 11 1 1SSK SER A 12 ? UNP P59595 ? ? 'cloning artifact' 12 12 1 1SSK GLY A 13 ? UNP P59595 ? ? 'cloning artifact' 13 13 1 1SSK LEU A 14 ? UNP P59595 ? ? 'cloning artifact' 14 14 1 1SSK VAL A 15 ? UNP P59595 ? ? 'cloning artifact' 15 15 1 1SSK PRO A 16 ? UNP P59595 ? ? 'cloning artifact' 16 16 1 1SSK ARG A 17 ? UNP P59595 ? ? 'cloning artifact' 17 17 1 1SSK GLY A 18 ? UNP P59595 ? ? 'cloning artifact' 18 18 1 1SSK SER A 19 ? UNP P59595 ? ? 'cloning artifact' 19 19 1 1SSK ALA A 20 ? UNP P59595 ? ? 'cloning artifact' 20 20 1 1SSK MET A 21 ? UNP P59595 ? ? 'initiating methionine' 21 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM Nacl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM N-terminal SARS CoV NP, U-15N,90% H2O/10% 2H2O, 50 mM sodium phosphate (pH 6.8) and 100 mM sodium chloride.' _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 800 2 ? Bruker AVANCE 600 3 ? Bruker AVANCE 500 # _pdbx_nmr_refine.entry_id 1SSK _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1SSK _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1SSK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_software.name CNS _pdbx_nmr_software.version 2000 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors brunger _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1SSK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1SSK _struct.title 'Structure of the N-terminal RNA-binding Domain of the SARS CoV Nucleocapsid Protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1SSK _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'nucleocapsid protein, STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 108 ? VAL A 111 ? ILE A 108 VAL A 111 A 2 ILE A 62 ? ALA A 68 ? ILE A 62 ALA A 68 A 3 ARG A 85 ? LEU A 91 ? ARG A 85 LEU A 91 A 4 ALA A 33 ? GLN A 36 ? ALA A 33 GLN A 36 A 5 PHE A 149 ? TYR A 150 ? PHE A 149 TYR A 150 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 111 ? O VAL A 111 N GLY A 63 ? N GLY A 63 A 2 3 N ALA A 68 ? N ALA A 68 O ARG A 85 ? O ARG A 85 A 3 4 O TRP A 86 ? O TRP A 86 N LEU A 34 ? N LEU A 34 A 4 5 N THR A 35 ? N THR A 35 O TYR A 150 ? O TYR A 150 # _database_PDB_matrix.entry_id 1SSK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1SSK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 TRP 110 110 110 TRP TRP A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 SER 158 158 158 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-06-08 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 4 ? ? 49.54 94.31 2 1 HIS A 7 ? ? -55.68 -176.69 3 1 HIS A 8 ? ? -67.77 73.70 4 1 SER A 11 ? ? 73.72 40.45 5 1 ARG A 17 ? ? 57.96 105.27 6 1 MET A 21 ? ? -59.42 -81.14 7 1 ASN A 26 ? ? -142.32 36.07 8 1 SER A 29 ? ? 168.45 86.16 9 1 PHE A 31 ? ? 168.58 -179.91 10 1 ARG A 43 ? ? 171.74 76.78 11 1 PRO A 45 ? ? -52.40 173.40 12 1 ARG A 46 ? ? -64.10 -177.79 13 1 GLN A 48 ? ? -136.09 -56.28 14 1 PRO A 51 ? ? -48.64 177.75 15 1 ASN A 53 ? ? 63.08 179.13 16 1 ASN A 55 ? ? -152.92 33.83 17 1 SER A 56 ? ? -97.76 36.85 18 1 ASP A 60 ? ? -150.55 54.14 19 1 ARG A 67 ? ? -52.34 106.66 20 1 GLU A 81 ? ? 63.44 94.57 21 1 THR A 93 ? ? -149.07 -54.09 22 1 PRO A 95 ? ? -60.98 -149.74 23 1 ALA A 97 ? ? 47.08 29.02 24 1 LEU A 99 ? ? -47.60 166.41 25 1 TYR A 101 ? ? 61.61 74.25 26 1 ALA A 103 ? ? -64.66 80.24 27 1 GLU A 114 ? ? -68.40 70.76 28 1 ASN A 118 ? ? 75.18 108.14 29 1 LYS A 121 ? ? 169.86 83.85 30 1 HIS A 123 ? ? 170.38 42.01 31 1 PRO A 129 ? ? -59.08 78.45 32 1 ASN A 130 ? ? 167.45 -34.32 33 1 ASN A 131 ? ? -73.79 -70.32 34 1 ALA A 133 ? ? -61.48 -163.66 35 1 VAL A 136 ? ? 47.81 114.00 36 1 LEU A 137 ? ? -43.18 167.67 37 1 GLN A 138 ? ? -158.11 86.27 38 1 PRO A 140 ? ? -59.39 -162.65 39 1 THR A 144 ? ? -57.48 -164.65 40 1 PRO A 146 ? ? -59.00 -147.88 41 1 LYS A 147 ? ? -46.16 -86.71 42 1 ALA A 151 ? ? -45.03 165.27 43 1 GLU A 152 ? ? -35.75 -36.68 44 1 SER A 154 ? ? 50.38 77.22 #