data_1SVQ # _entry.id 1SVQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1SVQ WWPDB D_1000176534 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1SVR _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SVQ _pdbx_database_status.recvd_initial_deposition_date 1994-10-12 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schnuchel, A.' 1 'Holak, T.A.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of severin domain 2 in solution.' J.Mol.Biol. 247 21 27 1995 JMOBAK UK 0022-2836 0070 ? 7897658 10.1006/jmbi.1994.0118 1 'Characterization of Actin-and Lipid-Binding Domains in Severin, a Ca(2+)-Dependent F-Actin Fragmenting Protein' Biochemistry 31 4779 ? 1992 BICHAW US 0006-2960 0033 ? ? ? 2 'Severin, Gelsolin, and Villin Share a Homologous Sequence in Regions Presumed to Contain F-Actin Severing Domains' J.Biol.Chem. 263 722 ? 1988 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Schnuchel, A.' 1 primary 'Wiltscheck, R.' 2 primary 'Eichinger, L.' 3 primary 'Schleicher, M.' 4 primary 'Holak, T.A.' 5 1 'Eichinger, L.' 6 1 'Schleicher, M.' 7 2 'Andre, E.' 8 2 'Lottspeich, F.' 9 2 'Schleicher, M.' 10 2 'Noegel, A.' 11 # _cell.entry_id 1SVQ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SVQ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description SEVERIN _entity.formula_weight 12260.842 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SGFNHVKPTEYKPRLLHISGDKNAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGL PKVEVFCETDSDIPAEFWKLLGGKGAIAAKHETA ; _entity_poly.pdbx_seq_one_letter_code_can ;SGFNHVKPTEYKPRLLHISGDKNAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGL PKVEVFCETDSDIPAEFWKLLGGKGAIAAKHETA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 PHE n 1 4 ASN n 1 5 HIS n 1 6 VAL n 1 7 LYS n 1 8 PRO n 1 9 THR n 1 10 GLU n 1 11 TYR n 1 12 LYS n 1 13 PRO n 1 14 ARG n 1 15 LEU n 1 16 LEU n 1 17 HIS n 1 18 ILE n 1 19 SER n 1 20 GLY n 1 21 ASP n 1 22 LYS n 1 23 ASN n 1 24 ALA n 1 25 LYS n 1 26 VAL n 1 27 ALA n 1 28 GLU n 1 29 VAL n 1 30 PRO n 1 31 LEU n 1 32 ALA n 1 33 THR n 1 34 SER n 1 35 SER n 1 36 LEU n 1 37 ASN n 1 38 SER n 1 39 GLY n 1 40 ASP n 1 41 CYS n 1 42 PHE n 1 43 LEU n 1 44 LEU n 1 45 ASP n 1 46 ALA n 1 47 GLY n 1 48 LEU n 1 49 THR n 1 50 ILE n 1 51 TYR n 1 52 GLN n 1 53 PHE n 1 54 ASN n 1 55 GLY n 1 56 SER n 1 57 LYS n 1 58 SER n 1 59 SER n 1 60 PRO n 1 61 GLN n 1 62 GLU n 1 63 LYS n 1 64 ASN n 1 65 LYS n 1 66 ALA n 1 67 ALA n 1 68 GLU n 1 69 VAL n 1 70 ALA n 1 71 ARG n 1 72 ALA n 1 73 ILE n 1 74 ASP n 1 75 ALA n 1 76 GLU n 1 77 ARG n 1 78 LYS n 1 79 GLY n 1 80 LEU n 1 81 PRO n 1 82 LYS n 1 83 VAL n 1 84 GLU n 1 85 VAL n 1 86 PHE n 1 87 CYS n 1 88 GLU n 1 89 THR n 1 90 ASP n 1 91 SER n 1 92 ASP n 1 93 ILE n 1 94 PRO n 1 95 ALA n 1 96 GLU n 1 97 PHE n 1 98 TRP n 1 99 LYS n 1 100 LEU n 1 101 LEU n 1 102 GLY n 1 103 GLY n 1 104 LYS n 1 105 GLY n 1 106 ALA n 1 107 ILE n 1 108 ALA n 1 109 ALA n 1 110 LYS n 1 111 HIS n 1 112 GLU n 1 113 THR n 1 114 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Dictyostelium _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Dictyostelium discoideum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 44689 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SEVE_DICDI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P10733 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MIKNRKLDITSTNVAGIGTDLDKKCRLDAASTEAQWKGVGQAPGLKIWRIENFKVVPVPESSYGKFYDGDSYIILHTFKE GNSLKHDIHFFLGTFTTQDEAGTAAYKTVELDDFLGGAPIQYRQCQSYESPSFLSLFPKYFILSGGVESGFNHVKPTEYK PRLLHISGDKNAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGLPKVEVFCETDSD IPAEFWKLLGGKGAIAAKHETAPTKSEKVLYKLSDASGSLKFSEVSRGKINKSSLKSEDVFIIDLGNEIYTWIGSKSSPN EKKTAFSHATQYLVNNKRCEYTPIVRVLENGTNQSFETLLSA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SVQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10733 _struct_ref_seq.db_align_beg 149 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 262 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 149 _struct_ref_seq.pdbx_auth_seq_align_end 262 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1SVQ _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1SVQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1SVQ _struct.title 'STRUCTURE OF SEVERIN DOMAIN 2 IN SOLUTION' _struct.pdbx_descriptor 'SEVERIN (DOMAIN 2 COMPRISING 114 RESIDUES) (DS111M) (NMR, 20 STRUCTURES)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SVQ _struct_keywords.pdbx_keywords ACTIN-BINDING _struct_keywords.text ACTIN-BINDING # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 GLU A 62 ? ASP A 74 ? GLU A 210 ASP A 222 1 ? 13 HELX_P HELX_P2 H2 ALA A 95 ? GLY A 103 ? ALA A 243 GLY A 251 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 41 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 87 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 189 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 235 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.065 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id B1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense B1 1 2 ? anti-parallel B1 2 3 ? anti-parallel B1 3 4 ? anti-parallel B1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id B1 1 ALA A 24 ? VAL A 29 ? ALA A 172 VAL A 177 B1 2 ARG A 14 ? GLY A 20 ? ARG A 162 GLY A 168 B1 3 ASP A 40 ? ALA A 46 ? ASP A 188 ALA A 194 B1 4 LEU A 48 ? ASN A 54 ? LEU A 196 ASN A 202 B1 5 LYS A 82 ? GLU A 88 ? LYS A 230 GLU A 236 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id B1 1 2 O VAL A 29 ? O VAL A 177 N LEU A 15 ? N LEU A 163 B1 2 3 O ILE A 18 ? O ILE A 166 N CYS A 41 ? N CYS A 189 B1 3 4 O LEU A 44 ? O LEU A 192 N TYR A 51 ? N TYR A 199 B1 4 5 N ILE A 50 ? N ILE A 198 O LYS A 82 ? O LYS A 230 # _database_PDB_matrix.entry_id 1SVQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1SVQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 149 ? ? ? A . n A 1 2 GLY 2 150 ? ? ? A . n A 1 3 PHE 3 151 ? ? ? A . n A 1 4 ASN 4 152 ? ? ? A . n A 1 5 HIS 5 153 ? ? ? A . n A 1 6 VAL 6 154 ? ? ? A . n A 1 7 LYS 7 155 ? ? ? A . n A 1 8 PRO 8 156 ? ? ? A . n A 1 9 THR 9 157 ? ? ? A . n A 1 10 GLU 10 158 158 GLU GLU A . n A 1 11 TYR 11 159 159 TYR TYR A . n A 1 12 LYS 12 160 160 LYS LYS A . n A 1 13 PRO 13 161 161 PRO PRO A . n A 1 14 ARG 14 162 162 ARG ARG A . n A 1 15 LEU 15 163 163 LEU LEU A . n A 1 16 LEU 16 164 164 LEU LEU A . n A 1 17 HIS 17 165 165 HIS HIS A . n A 1 18 ILE 18 166 166 ILE ILE A . n A 1 19 SER 19 167 167 SER SER A . n A 1 20 GLY 20 168 168 GLY GLY A . n A 1 21 ASP 21 169 169 ASP ASP A . n A 1 22 LYS 22 170 170 LYS LYS A . n A 1 23 ASN 23 171 171 ASN ASN A . n A 1 24 ALA 24 172 172 ALA ALA A . n A 1 25 LYS 25 173 173 LYS LYS A . n A 1 26 VAL 26 174 174 VAL VAL A . n A 1 27 ALA 27 175 175 ALA ALA A . n A 1 28 GLU 28 176 176 GLU GLU A . n A 1 29 VAL 29 177 177 VAL VAL A . n A 1 30 PRO 30 178 178 PRO PRO A . n A 1 31 LEU 31 179 179 LEU LEU A . n A 1 32 ALA 32 180 180 ALA ALA A . n A 1 33 THR 33 181 181 THR THR A . n A 1 34 SER 34 182 182 SER SER A . n A 1 35 SER 35 183 183 SER SER A . n A 1 36 LEU 36 184 184 LEU LEU A . n A 1 37 ASN 37 185 185 ASN ASN A . n A 1 38 SER 38 186 186 SER SER A . n A 1 39 GLY 39 187 187 GLY GLY A . n A 1 40 ASP 40 188 188 ASP ASP A . n A 1 41 CYS 41 189 189 CYS CYS A . n A 1 42 PHE 42 190 190 PHE PHE A . n A 1 43 LEU 43 191 191 LEU LEU A . n A 1 44 LEU 44 192 192 LEU LEU A . n A 1 45 ASP 45 193 193 ASP ASP A . n A 1 46 ALA 46 194 194 ALA ALA A . n A 1 47 GLY 47 195 195 GLY GLY A . n A 1 48 LEU 48 196 196 LEU LEU A . n A 1 49 THR 49 197 197 THR THR A . n A 1 50 ILE 50 198 198 ILE ILE A . n A 1 51 TYR 51 199 199 TYR TYR A . n A 1 52 GLN 52 200 200 GLN GLN A . n A 1 53 PHE 53 201 201 PHE PHE A . n A 1 54 ASN 54 202 202 ASN ASN A . n A 1 55 GLY 55 203 203 GLY GLY A . n A 1 56 SER 56 204 204 SER SER A . n A 1 57 LYS 57 205 205 LYS LYS A . n A 1 58 SER 58 206 206 SER SER A . n A 1 59 SER 59 207 207 SER SER A . n A 1 60 PRO 60 208 208 PRO PRO A . n A 1 61 GLN 61 209 209 GLN GLN A . n A 1 62 GLU 62 210 210 GLU GLU A . n A 1 63 LYS 63 211 211 LYS LYS A . n A 1 64 ASN 64 212 212 ASN ASN A . n A 1 65 LYS 65 213 213 LYS LYS A . n A 1 66 ALA 66 214 214 ALA ALA A . n A 1 67 ALA 67 215 215 ALA ALA A . n A 1 68 GLU 68 216 216 GLU GLU A . n A 1 69 VAL 69 217 217 VAL VAL A . n A 1 70 ALA 70 218 218 ALA ALA A . n A 1 71 ARG 71 219 219 ARG ARG A . n A 1 72 ALA 72 220 220 ALA ALA A . n A 1 73 ILE 73 221 221 ILE ILE A . n A 1 74 ASP 74 222 222 ASP ASP A . n A 1 75 ALA 75 223 223 ALA ALA A . n A 1 76 GLU 76 224 224 GLU GLU A . n A 1 77 ARG 77 225 225 ARG ARG A . n A 1 78 LYS 78 226 226 LYS LYS A . n A 1 79 GLY 79 227 227 GLY GLY A . n A 1 80 LEU 80 228 228 LEU LEU A . n A 1 81 PRO 81 229 229 PRO PRO A . n A 1 82 LYS 82 230 230 LYS LYS A . n A 1 83 VAL 83 231 231 VAL VAL A . n A 1 84 GLU 84 232 232 GLU GLU A . n A 1 85 VAL 85 233 233 VAL VAL A . n A 1 86 PHE 86 234 234 PHE PHE A . n A 1 87 CYS 87 235 235 CYS CYS A . n A 1 88 GLU 88 236 236 GLU GLU A . n A 1 89 THR 89 237 237 THR THR A . n A 1 90 ASP 90 238 238 ASP ASP A . n A 1 91 SER 91 239 239 SER SER A . n A 1 92 ASP 92 240 240 ASP ASP A . n A 1 93 ILE 93 241 241 ILE ILE A . n A 1 94 PRO 94 242 242 PRO PRO A . n A 1 95 ALA 95 243 243 ALA ALA A . n A 1 96 GLU 96 244 244 GLU GLU A . n A 1 97 PHE 97 245 245 PHE PHE A . n A 1 98 TRP 98 246 246 TRP TRP A . n A 1 99 LYS 99 247 247 LYS LYS A . n A 1 100 LEU 100 248 248 LEU LEU A . n A 1 101 LEU 101 249 249 LEU LEU A . n A 1 102 GLY 102 250 250 GLY GLY A . n A 1 103 GLY 103 251 251 GLY GLY A . n A 1 104 LYS 104 252 ? ? ? A . n A 1 105 GLY 105 253 ? ? ? A . n A 1 106 ALA 106 254 ? ? ? A . n A 1 107 ILE 107 255 ? ? ? A . n A 1 108 ALA 108 256 ? ? ? A . n A 1 109 ALA 109 257 ? ? ? A . n A 1 110 LYS 110 258 ? ? ? A . n A 1 111 HIS 111 259 ? ? ? A . n A 1 112 GLU 112 260 ? ? ? A . n A 1 113 THR 113 261 ? ? ? A . n A 1 114 ALA 114 262 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-02-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 O A GLY 187 ? ? O A GLY 203 ? ? 2.19 2 9 O A GLY 187 ? ? O A GLY 203 ? ? 2.14 3 10 O A SER 167 ? ? O A LYS 173 ? ? 2.18 4 18 O A PHE 190 ? ? O A PHE 201 ? ? 2.19 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 5 CB A CYS 189 ? ? SG A CYS 189 ? ? 1.924 1.818 0.106 0.017 N 2 6 CB A CYS 189 ? ? SG A CYS 189 ? ? 1.925 1.818 0.107 0.017 N 3 9 CB A CYS 189 ? ? SG A CYS 189 ? ? 1.938 1.818 0.120 0.017 N 4 9 CB A CYS 235 ? ? SG A CYS 235 ? ? 1.923 1.818 0.105 0.017 N 5 11 CB A CYS 189 ? ? SG A CYS 189 ? ? 1.925 1.818 0.107 0.017 N 6 12 CB A CYS 189 ? ? SG A CYS 189 ? ? 1.922 1.818 0.104 0.017 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 159 ? ? -49.56 170.91 2 1 ASP A 169 ? ? 37.44 -127.60 3 1 ASN A 171 ? ? -101.63 72.80 4 1 ALA A 175 ? ? 177.97 166.17 5 1 ALA A 180 ? ? -175.45 85.58 6 1 SER A 183 ? ? -68.47 2.94 7 1 LEU A 184 ? ? -50.96 -169.13 8 1 THR A 237 ? ? -124.54 -62.32 9 1 SER A 239 ? ? 57.51 10.66 10 1 ASP A 240 ? ? -58.07 -8.70 11 1 ILE A 241 ? ? -118.00 76.71 12 1 ALA A 243 ? ? -36.67 -25.71 13 2 ASP A 169 ? ? 37.86 -129.52 14 2 ASN A 171 ? ? -102.79 73.06 15 2 ALA A 175 ? ? 177.74 164.55 16 2 LEU A 179 ? ? -49.10 150.30 17 2 ALA A 180 ? ? -148.81 -158.09 18 2 THR A 181 ? ? 85.61 -38.95 19 2 LEU A 184 ? ? -50.43 -169.55 20 2 LYS A 205 ? ? -76.36 22.31 21 2 GLN A 209 ? ? -69.34 -71.78 22 2 PHE A 234 ? ? -171.28 126.36 23 2 THR A 237 ? ? -132.69 -64.76 24 2 SER A 239 ? ? 50.94 18.95 25 2 ASP A 240 ? ? -79.34 38.84 26 2 ALA A 243 ? ? -39.10 -24.98 27 3 ASP A 169 ? ? 38.09 -125.26 28 3 ASN A 171 ? ? -103.93 74.13 29 3 ALA A 175 ? ? 178.83 155.58 30 3 ALA A 180 ? ? -179.48 88.64 31 3 LEU A 184 ? ? -51.30 -171.09 32 3 PHE A 234 ? ? -174.68 121.77 33 3 THR A 237 ? ? -137.11 -65.00 34 3 ASP A 240 ? ? -78.91 40.47 35 3 ALA A 243 ? ? -36.40 -25.46 36 4 TYR A 159 ? ? -41.09 164.19 37 4 ASP A 169 ? ? 38.61 -127.28 38 4 ALA A 175 ? ? 178.13 167.01 39 4 ALA A 180 ? ? -171.55 85.21 40 4 LEU A 184 ? ? -53.11 -169.50 41 4 PHE A 234 ? ? -176.77 121.47 42 4 THR A 237 ? ? -123.88 -66.65 43 4 SER A 239 ? ? 51.15 17.44 44 5 ASP A 169 ? ? 38.17 -130.02 45 5 ASN A 171 ? ? -102.27 74.56 46 5 ALA A 175 ? ? 179.70 164.60 47 5 PRO A 178 ? ? -75.32 -168.20 48 5 ALA A 180 ? ? -152.46 -158.23 49 5 THR A 181 ? ? 88.17 -37.03 50 5 LEU A 184 ? ? -52.46 -166.95 51 5 PHE A 234 ? ? -173.81 122.41 52 5 THR A 237 ? ? -139.17 -65.03 53 5 SER A 239 ? ? 51.26 18.61 54 5 ASP A 240 ? ? -79.31 38.52 55 5 ALA A 243 ? ? -39.06 -24.82 56 6 ASP A 169 ? ? 37.92 -131.94 57 6 ALA A 175 ? ? 178.20 178.35 58 6 ALA A 180 ? ? -177.58 88.41 59 6 LEU A 184 ? ? -48.05 -176.93 60 6 GLN A 209 ? ? -69.91 -70.93 61 6 PHE A 234 ? ? -171.39 127.73 62 6 THR A 237 ? ? -145.63 -64.86 63 6 SER A 239 ? ? 49.93 19.13 64 6 ASP A 240 ? ? -81.02 42.86 65 6 ALA A 243 ? ? -36.90 -25.42 66 7 ASP A 169 ? ? 38.47 -130.56 67 7 ASN A 171 ? ? -100.42 70.81 68 7 ALA A 175 ? ? 178.32 165.90 69 7 ALA A 180 ? ? -149.55 -158.12 70 7 THR A 181 ? ? 87.05 -37.55 71 7 LEU A 184 ? ? -49.89 -173.96 72 7 GLN A 209 ? ? -67.36 -71.70 73 7 PHE A 234 ? ? -175.15 126.40 74 7 THR A 237 ? ? -137.10 -65.89 75 7 SER A 239 ? ? 51.08 19.36 76 7 ASP A 240 ? ? -78.78 37.92 77 7 ALA A 243 ? ? -39.12 -24.62 78 8 LYS A 160 ? ? -49.10 153.13 79 8 ASP A 169 ? ? 39.41 -126.36 80 8 ALA A 172 ? ? -57.85 109.03 81 8 ALA A 175 ? ? 178.13 165.55 82 8 THR A 181 ? ? 139.19 -51.78 83 8 LEU A 184 ? ? -52.88 -168.88 84 8 PHE A 234 ? ? -173.95 121.98 85 8 THR A 237 ? ? -131.90 -64.41 86 8 SER A 239 ? ? 50.68 18.11 87 8 ILE A 241 ? ? -116.30 76.31 88 8 ALA A 243 ? ? -37.83 -25.25 89 9 SER A 167 ? ? -174.79 -179.62 90 9 ASP A 169 ? ? 38.10 -130.68 91 9 ALA A 175 ? ? 177.74 170.72 92 9 LEU A 179 ? ? -48.02 151.00 93 9 THR A 181 ? ? 154.73 -51.99 94 9 LEU A 184 ? ? -53.56 -167.64 95 9 SER A 204 ? ? -50.80 -9.90 96 9 THR A 237 ? ? -127.25 -62.55 97 9 SER A 239 ? ? 60.82 -1.51 98 9 ASP A 240 ? ? 1.69 53.90 99 9 ILE A 241 ? ? -161.04 74.87 100 9 ALA A 243 ? ? -36.25 -26.24 101 10 ASP A 169 ? ? 38.27 -129.32 102 10 ASN A 171 ? ? -100.94 72.34 103 10 ALA A 175 ? ? 178.28 174.24 104 10 PRO A 178 ? ? -72.92 -169.37 105 10 ALA A 180 ? ? -145.72 -157.10 106 10 THR A 181 ? ? 88.35 -42.68 107 10 LEU A 184 ? ? -53.98 -168.54 108 10 PHE A 234 ? ? -171.62 123.22 109 10 THR A 237 ? ? -140.98 -63.45 110 10 SER A 239 ? ? 51.21 19.00 111 10 ASP A 240 ? ? -77.85 35.25 112 10 ALA A 243 ? ? -38.42 -24.96 113 11 ASP A 169 ? ? 37.42 -129.30 114 11 ALA A 175 ? ? 178.87 166.38 115 11 PRO A 178 ? ? -78.22 -169.61 116 11 THR A 181 ? ? 131.52 -54.73 117 11 LEU A 184 ? ? -56.34 -169.79 118 11 PRO A 208 ? ? -68.50 0.22 119 11 PHE A 234 ? ? -179.10 121.45 120 11 SER A 239 ? ? 55.78 12.80 121 11 ASP A 240 ? ? -35.99 -32.93 122 12 ASP A 169 ? ? 37.67 -129.21 123 12 ASN A 171 ? ? -103.61 73.78 124 12 ALA A 175 ? ? 177.81 169.40 125 12 ALA A 180 ? ? -175.53 88.08 126 12 LEU A 184 ? ? -46.24 179.16 127 12 GLN A 209 ? ? -69.23 -71.37 128 12 PHE A 234 ? ? -175.04 128.15 129 12 THR A 237 ? ? -134.87 -65.08 130 12 SER A 239 ? ? 46.33 17.37 131 12 ASP A 240 ? ? -73.91 27.97 132 12 ALA A 243 ? ? -36.97 -25.31 133 13 ASP A 169 ? ? 38.89 -126.79 134 13 ALA A 175 ? ? 177.37 162.88 135 13 ALA A 180 ? ? -176.24 87.69 136 13 LEU A 184 ? ? -49.82 -169.61 137 13 SER A 204 ? ? -56.07 -9.10 138 13 PRO A 208 ? ? -69.15 0.36 139 13 PHE A 234 ? ? -178.20 121.17 140 13 THR A 237 ? ? -145.61 -63.86 141 13 ASP A 238 ? ? -14.35 -67.41 142 13 ASP A 240 ? ? 5.80 45.22 143 13 ALA A 243 ? ? -35.75 -26.70 144 14 ASP A 169 ? ? 38.95 -131.25 145 14 ALA A 175 ? ? 177.73 167.09 146 14 PRO A 178 ? ? -73.11 -169.58 147 14 ALA A 180 ? ? -142.94 -158.92 148 14 THR A 181 ? ? 87.44 -40.45 149 14 LEU A 184 ? ? -51.90 -169.54 150 14 GLN A 200 ? ? -69.45 87.39 151 14 GLN A 209 ? ? -69.79 -72.58 152 14 THR A 237 ? ? -139.22 -65.16 153 14 SER A 239 ? ? 50.48 19.42 154 14 ASP A 240 ? ? -74.96 29.46 155 14 ALA A 243 ? ? -37.23 -24.77 156 15 ASP A 169 ? ? 38.85 -127.73 157 15 ALA A 175 ? ? 176.51 169.36 158 15 LEU A 184 ? ? -47.78 179.05 159 15 LYS A 205 ? ? -77.99 23.22 160 15 GLN A 209 ? ? -68.60 -72.04 161 15 PHE A 234 ? ? -175.97 128.76 162 15 THR A 237 ? ? -135.60 -65.69 163 15 SER A 239 ? ? 53.13 16.27 164 15 ASP A 240 ? ? -81.09 46.90 165 15 ALA A 243 ? ? -36.73 -25.23 166 16 TYR A 159 ? ? -43.29 164.99 167 16 ASP A 169 ? ? 39.50 -128.19 168 16 ALA A 175 ? ? 178.41 156.59 169 16 LEU A 179 ? ? -49.42 151.09 170 16 ALA A 180 ? ? -147.06 -157.80 171 16 THR A 181 ? ? 85.68 -42.05 172 16 LEU A 184 ? ? -52.18 -171.21 173 16 SER A 206 ? ? -168.12 117.47 174 16 PHE A 234 ? ? -171.77 121.25 175 16 THR A 237 ? ? -128.11 -66.15 176 16 SER A 239 ? ? 45.31 18.63 177 16 ASP A 240 ? ? -75.76 32.83 178 16 ALA A 243 ? ? -38.54 -25.20 179 17 ASP A 169 ? ? 38.81 -130.01 180 17 ASN A 171 ? ? -100.89 73.08 181 17 ALA A 175 ? ? 179.78 178.85 182 17 LEU A 179 ? ? -48.73 150.59 183 17 THR A 181 ? ? 153.95 -51.42 184 17 LEU A 184 ? ? -53.68 -166.28 185 17 GLN A 209 ? ? -53.11 -72.00 186 17 PHE A 234 ? ? -175.86 125.33 187 17 THR A 237 ? ? -134.56 -62.63 188 17 SER A 239 ? ? 50.63 17.82 189 17 ALA A 243 ? ? -38.76 -25.09 190 18 LYS A 160 ? ? -36.80 96.77 191 18 ASP A 169 ? ? 38.69 -125.90 192 18 ALA A 175 ? ? 177.88 162.84 193 18 LEU A 184 ? ? -52.16 -170.39 194 18 SER A 204 ? ? -55.96 -9.53 195 18 PRO A 208 ? ? -69.45 0.27 196 18 PHE A 234 ? ? -179.07 123.70 197 18 CYS A 235 ? ? -102.89 77.61 198 18 THR A 237 ? ? -127.89 -66.37 199 18 SER A 239 ? ? 57.78 13.21 200 18 ASP A 240 ? ? -79.29 41.90 201 18 ALA A 243 ? ? -36.71 -25.60 202 19 ASP A 169 ? ? 38.34 -128.65 203 19 ALA A 175 ? ? 178.76 165.54 204 19 ALA A 180 ? ? -173.16 92.63 205 19 LEU A 184 ? ? -46.79 174.45 206 19 GLN A 209 ? ? -66.75 -71.95 207 19 PHE A 234 ? ? -177.07 128.85 208 19 THR A 237 ? ? -142.64 -65.15 209 19 SER A 239 ? ? 50.69 17.26 210 19 ASP A 240 ? ? -81.07 42.22 211 19 ALA A 243 ? ? -34.95 -28.30 212 20 ASP A 169 ? ? 38.23 -127.36 213 20 ALA A 175 ? ? 179.88 161.32 214 20 ALA A 180 ? ? -177.49 90.14 215 20 LEU A 184 ? ? -48.04 -175.89 216 20 SER A 204 ? ? -57.60 -8.77 217 20 PRO A 208 ? ? -69.53 0.70 218 20 PHE A 234 ? ? -172.21 117.30 219 20 THR A 237 ? ? -133.88 -66.58 220 20 SER A 239 ? ? 51.18 18.64 221 20 ASP A 240 ? ? -78.79 39.53 222 20 ALA A 243 ? ? -37.01 -25.88 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 162 ? ? 0.095 'SIDE CHAIN' 2 1 ARG A 219 ? ? 0.238 'SIDE CHAIN' 3 1 ARG A 225 ? ? 0.265 'SIDE CHAIN' 4 2 ARG A 162 ? ? 0.301 'SIDE CHAIN' 5 2 ARG A 219 ? ? 0.309 'SIDE CHAIN' 6 2 ARG A 225 ? ? 0.318 'SIDE CHAIN' 7 3 ARG A 162 ? ? 0.276 'SIDE CHAIN' 8 3 ARG A 219 ? ? 0.316 'SIDE CHAIN' 9 3 ARG A 225 ? ? 0.218 'SIDE CHAIN' 10 4 ARG A 162 ? ? 0.293 'SIDE CHAIN' 11 4 ARG A 219 ? ? 0.267 'SIDE CHAIN' 12 4 ARG A 225 ? ? 0.302 'SIDE CHAIN' 13 5 ARG A 162 ? ? 0.220 'SIDE CHAIN' 14 5 ARG A 219 ? ? 0.312 'SIDE CHAIN' 15 6 ARG A 162 ? ? 0.315 'SIDE CHAIN' 16 6 ARG A 219 ? ? 0.083 'SIDE CHAIN' 17 6 ARG A 225 ? ? 0.314 'SIDE CHAIN' 18 7 ARG A 162 ? ? 0.314 'SIDE CHAIN' 19 7 ARG A 219 ? ? 0.180 'SIDE CHAIN' 20 7 ARG A 225 ? ? 0.310 'SIDE CHAIN' 21 8 ARG A 162 ? ? 0.314 'SIDE CHAIN' 22 8 ARG A 219 ? ? 0.139 'SIDE CHAIN' 23 8 ARG A 225 ? ? 0.294 'SIDE CHAIN' 24 9 ARG A 162 ? ? 0.317 'SIDE CHAIN' 25 9 ARG A 219 ? ? 0.273 'SIDE CHAIN' 26 9 ARG A 225 ? ? 0.163 'SIDE CHAIN' 27 10 ARG A 162 ? ? 0.230 'SIDE CHAIN' 28 10 ARG A 219 ? ? 0.213 'SIDE CHAIN' 29 10 ARG A 225 ? ? 0.244 'SIDE CHAIN' 30 11 ARG A 162 ? ? 0.295 'SIDE CHAIN' 31 11 ARG A 219 ? ? 0.233 'SIDE CHAIN' 32 11 ARG A 225 ? ? 0.318 'SIDE CHAIN' 33 12 ARG A 162 ? ? 0.317 'SIDE CHAIN' 34 12 ARG A 219 ? ? 0.247 'SIDE CHAIN' 35 12 ARG A 225 ? ? 0.118 'SIDE CHAIN' 36 13 ARG A 162 ? ? 0.210 'SIDE CHAIN' 37 13 ARG A 219 ? ? 0.262 'SIDE CHAIN' 38 13 ARG A 225 ? ? 0.308 'SIDE CHAIN' 39 14 ARG A 162 ? ? 0.310 'SIDE CHAIN' 40 14 ARG A 219 ? ? 0.312 'SIDE CHAIN' 41 14 ARG A 225 ? ? 0.317 'SIDE CHAIN' 42 15 ARG A 162 ? ? 0.246 'SIDE CHAIN' 43 15 ARG A 219 ? ? 0.284 'SIDE CHAIN' 44 15 ARG A 225 ? ? 0.313 'SIDE CHAIN' 45 16 ARG A 162 ? ? 0.295 'SIDE CHAIN' 46 16 ARG A 219 ? ? 0.256 'SIDE CHAIN' 47 16 ARG A 225 ? ? 0.122 'SIDE CHAIN' 48 17 ARG A 162 ? ? 0.302 'SIDE CHAIN' 49 17 ARG A 219 ? ? 0.199 'SIDE CHAIN' 50 17 ARG A 225 ? ? 0.301 'SIDE CHAIN' 51 18 ARG A 162 ? ? 0.300 'SIDE CHAIN' 52 18 ARG A 219 ? ? 0.262 'SIDE CHAIN' 53 18 ARG A 225 ? ? 0.282 'SIDE CHAIN' 54 19 ARG A 162 ? ? 0.309 'SIDE CHAIN' 55 19 ARG A 219 ? ? 0.251 'SIDE CHAIN' 56 19 ARG A 225 ? ? 0.315 'SIDE CHAIN' 57 20 ARG A 219 ? ? 0.104 'SIDE CHAIN' 58 20 ARG A 225 ? ? 0.090 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 149 ? A SER 1 2 1 Y 1 A GLY 150 ? A GLY 2 3 1 Y 1 A PHE 151 ? A PHE 3 4 1 Y 1 A ASN 152 ? A ASN 4 5 1 Y 1 A HIS 153 ? A HIS 5 6 1 Y 1 A VAL 154 ? A VAL 6 7 1 Y 1 A LYS 155 ? A LYS 7 8 1 Y 1 A PRO 156 ? A PRO 8 9 1 Y 1 A THR 157 ? A THR 9 10 1 Y 1 A LYS 252 ? A LYS 104 11 1 Y 1 A GLY 253 ? A GLY 105 12 1 Y 1 A ALA 254 ? A ALA 106 13 1 Y 1 A ILE 255 ? A ILE 107 14 1 Y 1 A ALA 256 ? A ALA 108 15 1 Y 1 A ALA 257 ? A ALA 109 16 1 Y 1 A LYS 258 ? A LYS 110 17 1 Y 1 A HIS 259 ? A HIS 111 18 1 Y 1 A GLU 260 ? A GLU 112 19 1 Y 1 A THR 261 ? A THR 113 20 1 Y 1 A ALA 262 ? A ALA 114 21 2 Y 1 A SER 149 ? A SER 1 22 2 Y 1 A GLY 150 ? A GLY 2 23 2 Y 1 A PHE 151 ? A PHE 3 24 2 Y 1 A ASN 152 ? A ASN 4 25 2 Y 1 A HIS 153 ? A HIS 5 26 2 Y 1 A VAL 154 ? A VAL 6 27 2 Y 1 A LYS 155 ? A LYS 7 28 2 Y 1 A PRO 156 ? A PRO 8 29 2 Y 1 A THR 157 ? A THR 9 30 2 Y 1 A LYS 252 ? A LYS 104 31 2 Y 1 A GLY 253 ? A GLY 105 32 2 Y 1 A ALA 254 ? A ALA 106 33 2 Y 1 A ILE 255 ? A ILE 107 34 2 Y 1 A ALA 256 ? A ALA 108 35 2 Y 1 A ALA 257 ? A ALA 109 36 2 Y 1 A LYS 258 ? A LYS 110 37 2 Y 1 A HIS 259 ? A HIS 111 38 2 Y 1 A GLU 260 ? A GLU 112 39 2 Y 1 A THR 261 ? A THR 113 40 2 Y 1 A ALA 262 ? A ALA 114 41 3 Y 1 A SER 149 ? A SER 1 42 3 Y 1 A GLY 150 ? A GLY 2 43 3 Y 1 A PHE 151 ? A PHE 3 44 3 Y 1 A ASN 152 ? A ASN 4 45 3 Y 1 A HIS 153 ? A HIS 5 46 3 Y 1 A VAL 154 ? A VAL 6 47 3 Y 1 A LYS 155 ? A LYS 7 48 3 Y 1 A PRO 156 ? A PRO 8 49 3 Y 1 A THR 157 ? A THR 9 50 3 Y 1 A LYS 252 ? A LYS 104 51 3 Y 1 A GLY 253 ? A GLY 105 52 3 Y 1 A ALA 254 ? A ALA 106 53 3 Y 1 A ILE 255 ? A ILE 107 54 3 Y 1 A ALA 256 ? A ALA 108 55 3 Y 1 A ALA 257 ? A ALA 109 56 3 Y 1 A LYS 258 ? A LYS 110 57 3 Y 1 A HIS 259 ? A HIS 111 58 3 Y 1 A GLU 260 ? A GLU 112 59 3 Y 1 A THR 261 ? A THR 113 60 3 Y 1 A ALA 262 ? A ALA 114 61 4 Y 1 A SER 149 ? A SER 1 62 4 Y 1 A GLY 150 ? A GLY 2 63 4 Y 1 A PHE 151 ? A PHE 3 64 4 Y 1 A ASN 152 ? A ASN 4 65 4 Y 1 A HIS 153 ? A HIS 5 66 4 Y 1 A VAL 154 ? A VAL 6 67 4 Y 1 A LYS 155 ? A LYS 7 68 4 Y 1 A PRO 156 ? A PRO 8 69 4 Y 1 A THR 157 ? A THR 9 70 4 Y 1 A LYS 252 ? A LYS 104 71 4 Y 1 A GLY 253 ? A GLY 105 72 4 Y 1 A ALA 254 ? A ALA 106 73 4 Y 1 A ILE 255 ? A ILE 107 74 4 Y 1 A ALA 256 ? A ALA 108 75 4 Y 1 A ALA 257 ? A ALA 109 76 4 Y 1 A LYS 258 ? A LYS 110 77 4 Y 1 A HIS 259 ? A HIS 111 78 4 Y 1 A GLU 260 ? A GLU 112 79 4 Y 1 A THR 261 ? A THR 113 80 4 Y 1 A ALA 262 ? A ALA 114 81 5 Y 1 A SER 149 ? A SER 1 82 5 Y 1 A GLY 150 ? A GLY 2 83 5 Y 1 A PHE 151 ? A PHE 3 84 5 Y 1 A ASN 152 ? A ASN 4 85 5 Y 1 A HIS 153 ? A HIS 5 86 5 Y 1 A VAL 154 ? A VAL 6 87 5 Y 1 A LYS 155 ? A LYS 7 88 5 Y 1 A PRO 156 ? A PRO 8 89 5 Y 1 A THR 157 ? A THR 9 90 5 Y 1 A LYS 252 ? A LYS 104 91 5 Y 1 A GLY 253 ? A GLY 105 92 5 Y 1 A ALA 254 ? A ALA 106 93 5 Y 1 A ILE 255 ? A ILE 107 94 5 Y 1 A ALA 256 ? A ALA 108 95 5 Y 1 A ALA 257 ? A ALA 109 96 5 Y 1 A LYS 258 ? A LYS 110 97 5 Y 1 A HIS 259 ? A HIS 111 98 5 Y 1 A GLU 260 ? A GLU 112 99 5 Y 1 A THR 261 ? A THR 113 100 5 Y 1 A ALA 262 ? A ALA 114 101 6 Y 1 A SER 149 ? A SER 1 102 6 Y 1 A GLY 150 ? A GLY 2 103 6 Y 1 A PHE 151 ? A PHE 3 104 6 Y 1 A ASN 152 ? A ASN 4 105 6 Y 1 A HIS 153 ? A HIS 5 106 6 Y 1 A VAL 154 ? A VAL 6 107 6 Y 1 A LYS 155 ? A LYS 7 108 6 Y 1 A PRO 156 ? A PRO 8 109 6 Y 1 A THR 157 ? A THR 9 110 6 Y 1 A LYS 252 ? A LYS 104 111 6 Y 1 A GLY 253 ? A GLY 105 112 6 Y 1 A ALA 254 ? A ALA 106 113 6 Y 1 A ILE 255 ? A ILE 107 114 6 Y 1 A ALA 256 ? A ALA 108 115 6 Y 1 A ALA 257 ? A ALA 109 116 6 Y 1 A LYS 258 ? A LYS 110 117 6 Y 1 A HIS 259 ? A HIS 111 118 6 Y 1 A GLU 260 ? A GLU 112 119 6 Y 1 A THR 261 ? A THR 113 120 6 Y 1 A ALA 262 ? A ALA 114 121 7 Y 1 A SER 149 ? A SER 1 122 7 Y 1 A GLY 150 ? A GLY 2 123 7 Y 1 A PHE 151 ? A PHE 3 124 7 Y 1 A ASN 152 ? A ASN 4 125 7 Y 1 A HIS 153 ? A HIS 5 126 7 Y 1 A VAL 154 ? A VAL 6 127 7 Y 1 A LYS 155 ? A LYS 7 128 7 Y 1 A PRO 156 ? A PRO 8 129 7 Y 1 A THR 157 ? A THR 9 130 7 Y 1 A LYS 252 ? A LYS 104 131 7 Y 1 A GLY 253 ? A GLY 105 132 7 Y 1 A ALA 254 ? A ALA 106 133 7 Y 1 A ILE 255 ? A ILE 107 134 7 Y 1 A ALA 256 ? A ALA 108 135 7 Y 1 A ALA 257 ? A ALA 109 136 7 Y 1 A LYS 258 ? A LYS 110 137 7 Y 1 A HIS 259 ? A HIS 111 138 7 Y 1 A GLU 260 ? A GLU 112 139 7 Y 1 A THR 261 ? A THR 113 140 7 Y 1 A ALA 262 ? A ALA 114 141 8 Y 1 A SER 149 ? A SER 1 142 8 Y 1 A GLY 150 ? A GLY 2 143 8 Y 1 A PHE 151 ? A PHE 3 144 8 Y 1 A ASN 152 ? A ASN 4 145 8 Y 1 A HIS 153 ? A HIS 5 146 8 Y 1 A VAL 154 ? A VAL 6 147 8 Y 1 A LYS 155 ? A LYS 7 148 8 Y 1 A PRO 156 ? A PRO 8 149 8 Y 1 A THR 157 ? A THR 9 150 8 Y 1 A LYS 252 ? A LYS 104 151 8 Y 1 A GLY 253 ? A GLY 105 152 8 Y 1 A ALA 254 ? A ALA 106 153 8 Y 1 A ILE 255 ? A ILE 107 154 8 Y 1 A ALA 256 ? A ALA 108 155 8 Y 1 A ALA 257 ? A ALA 109 156 8 Y 1 A LYS 258 ? A LYS 110 157 8 Y 1 A HIS 259 ? A HIS 111 158 8 Y 1 A GLU 260 ? A GLU 112 159 8 Y 1 A THR 261 ? A THR 113 160 8 Y 1 A ALA 262 ? A ALA 114 161 9 Y 1 A SER 149 ? A SER 1 162 9 Y 1 A GLY 150 ? A GLY 2 163 9 Y 1 A PHE 151 ? A PHE 3 164 9 Y 1 A ASN 152 ? A ASN 4 165 9 Y 1 A HIS 153 ? A HIS 5 166 9 Y 1 A VAL 154 ? A VAL 6 167 9 Y 1 A LYS 155 ? A LYS 7 168 9 Y 1 A PRO 156 ? A PRO 8 169 9 Y 1 A THR 157 ? A THR 9 170 9 Y 1 A LYS 252 ? A LYS 104 171 9 Y 1 A GLY 253 ? A GLY 105 172 9 Y 1 A ALA 254 ? A ALA 106 173 9 Y 1 A ILE 255 ? A ILE 107 174 9 Y 1 A ALA 256 ? A ALA 108 175 9 Y 1 A ALA 257 ? A ALA 109 176 9 Y 1 A LYS 258 ? A LYS 110 177 9 Y 1 A HIS 259 ? A HIS 111 178 9 Y 1 A GLU 260 ? A GLU 112 179 9 Y 1 A THR 261 ? A THR 113 180 9 Y 1 A ALA 262 ? A ALA 114 181 10 Y 1 A SER 149 ? A SER 1 182 10 Y 1 A GLY 150 ? A GLY 2 183 10 Y 1 A PHE 151 ? A PHE 3 184 10 Y 1 A ASN 152 ? A ASN 4 185 10 Y 1 A HIS 153 ? A HIS 5 186 10 Y 1 A VAL 154 ? A VAL 6 187 10 Y 1 A LYS 155 ? A LYS 7 188 10 Y 1 A PRO 156 ? A PRO 8 189 10 Y 1 A THR 157 ? A THR 9 190 10 Y 1 A LYS 252 ? A LYS 104 191 10 Y 1 A GLY 253 ? A GLY 105 192 10 Y 1 A ALA 254 ? A ALA 106 193 10 Y 1 A ILE 255 ? A ILE 107 194 10 Y 1 A ALA 256 ? A ALA 108 195 10 Y 1 A ALA 257 ? A ALA 109 196 10 Y 1 A LYS 258 ? A LYS 110 197 10 Y 1 A HIS 259 ? A HIS 111 198 10 Y 1 A GLU 260 ? A GLU 112 199 10 Y 1 A THR 261 ? A THR 113 200 10 Y 1 A ALA 262 ? A ALA 114 201 11 Y 1 A SER 149 ? A SER 1 202 11 Y 1 A GLY 150 ? A GLY 2 203 11 Y 1 A PHE 151 ? A PHE 3 204 11 Y 1 A ASN 152 ? A ASN 4 205 11 Y 1 A HIS 153 ? A HIS 5 206 11 Y 1 A VAL 154 ? A VAL 6 207 11 Y 1 A LYS 155 ? A LYS 7 208 11 Y 1 A PRO 156 ? A PRO 8 209 11 Y 1 A THR 157 ? A THR 9 210 11 Y 1 A LYS 252 ? A LYS 104 211 11 Y 1 A GLY 253 ? A GLY 105 212 11 Y 1 A ALA 254 ? A ALA 106 213 11 Y 1 A ILE 255 ? A ILE 107 214 11 Y 1 A ALA 256 ? A ALA 108 215 11 Y 1 A ALA 257 ? A ALA 109 216 11 Y 1 A LYS 258 ? A LYS 110 217 11 Y 1 A HIS 259 ? A HIS 111 218 11 Y 1 A GLU 260 ? A GLU 112 219 11 Y 1 A THR 261 ? A THR 113 220 11 Y 1 A ALA 262 ? A ALA 114 221 12 Y 1 A SER 149 ? A SER 1 222 12 Y 1 A GLY 150 ? A GLY 2 223 12 Y 1 A PHE 151 ? A PHE 3 224 12 Y 1 A ASN 152 ? A ASN 4 225 12 Y 1 A HIS 153 ? A HIS 5 226 12 Y 1 A VAL 154 ? A VAL 6 227 12 Y 1 A LYS 155 ? A LYS 7 228 12 Y 1 A PRO 156 ? A PRO 8 229 12 Y 1 A THR 157 ? A THR 9 230 12 Y 1 A LYS 252 ? A LYS 104 231 12 Y 1 A GLY 253 ? A GLY 105 232 12 Y 1 A ALA 254 ? A ALA 106 233 12 Y 1 A ILE 255 ? A ILE 107 234 12 Y 1 A ALA 256 ? A ALA 108 235 12 Y 1 A ALA 257 ? A ALA 109 236 12 Y 1 A LYS 258 ? A LYS 110 237 12 Y 1 A HIS 259 ? A HIS 111 238 12 Y 1 A GLU 260 ? A GLU 112 239 12 Y 1 A THR 261 ? A THR 113 240 12 Y 1 A ALA 262 ? A ALA 114 241 13 Y 1 A SER 149 ? A SER 1 242 13 Y 1 A GLY 150 ? A GLY 2 243 13 Y 1 A PHE 151 ? A PHE 3 244 13 Y 1 A ASN 152 ? A ASN 4 245 13 Y 1 A HIS 153 ? A HIS 5 246 13 Y 1 A VAL 154 ? A VAL 6 247 13 Y 1 A LYS 155 ? A LYS 7 248 13 Y 1 A PRO 156 ? A PRO 8 249 13 Y 1 A THR 157 ? A THR 9 250 13 Y 1 A LYS 252 ? A LYS 104 251 13 Y 1 A GLY 253 ? A GLY 105 252 13 Y 1 A ALA 254 ? A ALA 106 253 13 Y 1 A ILE 255 ? A ILE 107 254 13 Y 1 A ALA 256 ? A ALA 108 255 13 Y 1 A ALA 257 ? A ALA 109 256 13 Y 1 A LYS 258 ? A LYS 110 257 13 Y 1 A HIS 259 ? A HIS 111 258 13 Y 1 A GLU 260 ? A GLU 112 259 13 Y 1 A THR 261 ? A THR 113 260 13 Y 1 A ALA 262 ? A ALA 114 261 14 Y 1 A SER 149 ? A SER 1 262 14 Y 1 A GLY 150 ? A GLY 2 263 14 Y 1 A PHE 151 ? A PHE 3 264 14 Y 1 A ASN 152 ? A ASN 4 265 14 Y 1 A HIS 153 ? A HIS 5 266 14 Y 1 A VAL 154 ? A VAL 6 267 14 Y 1 A LYS 155 ? A LYS 7 268 14 Y 1 A PRO 156 ? A PRO 8 269 14 Y 1 A THR 157 ? A THR 9 270 14 Y 1 A LYS 252 ? A LYS 104 271 14 Y 1 A GLY 253 ? A GLY 105 272 14 Y 1 A ALA 254 ? A ALA 106 273 14 Y 1 A ILE 255 ? A ILE 107 274 14 Y 1 A ALA 256 ? A ALA 108 275 14 Y 1 A ALA 257 ? A ALA 109 276 14 Y 1 A LYS 258 ? A LYS 110 277 14 Y 1 A HIS 259 ? A HIS 111 278 14 Y 1 A GLU 260 ? A GLU 112 279 14 Y 1 A THR 261 ? A THR 113 280 14 Y 1 A ALA 262 ? A ALA 114 281 15 Y 1 A SER 149 ? A SER 1 282 15 Y 1 A GLY 150 ? A GLY 2 283 15 Y 1 A PHE 151 ? A PHE 3 284 15 Y 1 A ASN 152 ? A ASN 4 285 15 Y 1 A HIS 153 ? A HIS 5 286 15 Y 1 A VAL 154 ? A VAL 6 287 15 Y 1 A LYS 155 ? A LYS 7 288 15 Y 1 A PRO 156 ? A PRO 8 289 15 Y 1 A THR 157 ? A THR 9 290 15 Y 1 A LYS 252 ? A LYS 104 291 15 Y 1 A GLY 253 ? A GLY 105 292 15 Y 1 A ALA 254 ? A ALA 106 293 15 Y 1 A ILE 255 ? A ILE 107 294 15 Y 1 A ALA 256 ? A ALA 108 295 15 Y 1 A ALA 257 ? A ALA 109 296 15 Y 1 A LYS 258 ? A LYS 110 297 15 Y 1 A HIS 259 ? A HIS 111 298 15 Y 1 A GLU 260 ? A GLU 112 299 15 Y 1 A THR 261 ? A THR 113 300 15 Y 1 A ALA 262 ? A ALA 114 301 16 Y 1 A SER 149 ? A SER 1 302 16 Y 1 A GLY 150 ? A GLY 2 303 16 Y 1 A PHE 151 ? A PHE 3 304 16 Y 1 A ASN 152 ? A ASN 4 305 16 Y 1 A HIS 153 ? A HIS 5 306 16 Y 1 A VAL 154 ? A VAL 6 307 16 Y 1 A LYS 155 ? A LYS 7 308 16 Y 1 A PRO 156 ? A PRO 8 309 16 Y 1 A THR 157 ? A THR 9 310 16 Y 1 A LYS 252 ? A LYS 104 311 16 Y 1 A GLY 253 ? A GLY 105 312 16 Y 1 A ALA 254 ? A ALA 106 313 16 Y 1 A ILE 255 ? A ILE 107 314 16 Y 1 A ALA 256 ? A ALA 108 315 16 Y 1 A ALA 257 ? A ALA 109 316 16 Y 1 A LYS 258 ? A LYS 110 317 16 Y 1 A HIS 259 ? A HIS 111 318 16 Y 1 A GLU 260 ? A GLU 112 319 16 Y 1 A THR 261 ? A THR 113 320 16 Y 1 A ALA 262 ? A ALA 114 321 17 Y 1 A SER 149 ? A SER 1 322 17 Y 1 A GLY 150 ? A GLY 2 323 17 Y 1 A PHE 151 ? A PHE 3 324 17 Y 1 A ASN 152 ? A ASN 4 325 17 Y 1 A HIS 153 ? A HIS 5 326 17 Y 1 A VAL 154 ? A VAL 6 327 17 Y 1 A LYS 155 ? A LYS 7 328 17 Y 1 A PRO 156 ? A PRO 8 329 17 Y 1 A THR 157 ? A THR 9 330 17 Y 1 A LYS 252 ? A LYS 104 331 17 Y 1 A GLY 253 ? A GLY 105 332 17 Y 1 A ALA 254 ? A ALA 106 333 17 Y 1 A ILE 255 ? A ILE 107 334 17 Y 1 A ALA 256 ? A ALA 108 335 17 Y 1 A ALA 257 ? A ALA 109 336 17 Y 1 A LYS 258 ? A LYS 110 337 17 Y 1 A HIS 259 ? A HIS 111 338 17 Y 1 A GLU 260 ? A GLU 112 339 17 Y 1 A THR 261 ? A THR 113 340 17 Y 1 A ALA 262 ? A ALA 114 341 18 Y 1 A SER 149 ? A SER 1 342 18 Y 1 A GLY 150 ? A GLY 2 343 18 Y 1 A PHE 151 ? A PHE 3 344 18 Y 1 A ASN 152 ? A ASN 4 345 18 Y 1 A HIS 153 ? A HIS 5 346 18 Y 1 A VAL 154 ? A VAL 6 347 18 Y 1 A LYS 155 ? A LYS 7 348 18 Y 1 A PRO 156 ? A PRO 8 349 18 Y 1 A THR 157 ? A THR 9 350 18 Y 1 A LYS 252 ? A LYS 104 351 18 Y 1 A GLY 253 ? A GLY 105 352 18 Y 1 A ALA 254 ? A ALA 106 353 18 Y 1 A ILE 255 ? A ILE 107 354 18 Y 1 A ALA 256 ? A ALA 108 355 18 Y 1 A ALA 257 ? A ALA 109 356 18 Y 1 A LYS 258 ? A LYS 110 357 18 Y 1 A HIS 259 ? A HIS 111 358 18 Y 1 A GLU 260 ? A GLU 112 359 18 Y 1 A THR 261 ? A THR 113 360 18 Y 1 A ALA 262 ? A ALA 114 361 19 Y 1 A SER 149 ? A SER 1 362 19 Y 1 A GLY 150 ? A GLY 2 363 19 Y 1 A PHE 151 ? A PHE 3 364 19 Y 1 A ASN 152 ? A ASN 4 365 19 Y 1 A HIS 153 ? A HIS 5 366 19 Y 1 A VAL 154 ? A VAL 6 367 19 Y 1 A LYS 155 ? A LYS 7 368 19 Y 1 A PRO 156 ? A PRO 8 369 19 Y 1 A THR 157 ? A THR 9 370 19 Y 1 A LYS 252 ? A LYS 104 371 19 Y 1 A GLY 253 ? A GLY 105 372 19 Y 1 A ALA 254 ? A ALA 106 373 19 Y 1 A ILE 255 ? A ILE 107 374 19 Y 1 A ALA 256 ? A ALA 108 375 19 Y 1 A ALA 257 ? A ALA 109 376 19 Y 1 A LYS 258 ? A LYS 110 377 19 Y 1 A HIS 259 ? A HIS 111 378 19 Y 1 A GLU 260 ? A GLU 112 379 19 Y 1 A THR 261 ? A THR 113 380 19 Y 1 A ALA 262 ? A ALA 114 381 20 Y 1 A SER 149 ? A SER 1 382 20 Y 1 A GLY 150 ? A GLY 2 383 20 Y 1 A PHE 151 ? A PHE 3 384 20 Y 1 A ASN 152 ? A ASN 4 385 20 Y 1 A HIS 153 ? A HIS 5 386 20 Y 1 A VAL 154 ? A VAL 6 387 20 Y 1 A LYS 155 ? A LYS 7 388 20 Y 1 A PRO 156 ? A PRO 8 389 20 Y 1 A THR 157 ? A THR 9 390 20 Y 1 A LYS 252 ? A LYS 104 391 20 Y 1 A GLY 253 ? A GLY 105 392 20 Y 1 A ALA 254 ? A ALA 106 393 20 Y 1 A ILE 255 ? A ILE 107 394 20 Y 1 A ALA 256 ? A ALA 108 395 20 Y 1 A ALA 257 ? A ALA 109 396 20 Y 1 A LYS 258 ? A LYS 110 397 20 Y 1 A HIS 259 ? A HIS 111 398 20 Y 1 A GLU 260 ? A GLU 112 399 20 Y 1 A THR 261 ? A THR 113 400 20 Y 1 A ALA 262 ? A ALA 114 #