data_1SX6 # _entry.id 1SX6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1SX6 RCSB RCSB022061 WWPDB D_1000022061 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1SWX _pdbx_database_related.details 'The same protein in apo-form' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SX6 _pdbx_database_status.recvd_initial_deposition_date 2004-03-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Malinina, L.' 1 'Malakhova, M.L.' 2 'Teplov, A.' 3 'Brown, R.E.' 4 'Patel, D.J.' 5 # _citation.id primary _citation.title 'Structural basis for glycosphingolipid transfer specificity.' _citation.journal_abbrev Nature _citation.journal_volume 430 _citation.page_first 1048 _citation.page_last 1053 _citation.year 2004 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15329726 _citation.pdbx_database_id_DOI 10.1038/nature02856 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Malinina, L.' 1 ? primary 'Malakhova, M.L.' 2 ? primary 'Teplov, A.' 3 ? primary 'Brown, R.E.' 4 ? primary 'Patel, D.J.' 5 ? # _cell.entry_id 1SX6 _cell.length_a 75.599 _cell.length_b 49.073 _cell.length_c 68.538 _cell.angle_alpha 90.00 _cell.angle_beta 122.52 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SX6 _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Glycolipid transfer protein' 23877.777 1 ? ? ? ? 2 branched man 'beta-D-galactopyranose-(1-4)-beta-D-glucopyranose' 342.297 1 ? ? ? ? 3 non-polymer syn SPHINGOSINE 299.492 1 ? ? ? ? 4 non-polymer syn 'OLEIC ACID' 282.461 1 ? ? ? ? 5 non-polymer syn N-OCTANE 114.229 1 ? ? ? ? 6 water nat water 18.015 160 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 GLTP 2 beta-lactose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTLQNILEVEKEM YGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSD FLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV ; _entity_poly.pdbx_seq_one_letter_code_can ;MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTLQNILEVEKEM YGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSD FLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LEU n 1 4 LEU n 1 5 ALA n 1 6 GLU n 1 7 HIS n 1 8 LEU n 1 9 LEU n 1 10 LYS n 1 11 PRO n 1 12 LEU n 1 13 PRO n 1 14 ALA n 1 15 ASP n 1 16 LYS n 1 17 GLN n 1 18 ILE n 1 19 GLU n 1 20 THR n 1 21 GLY n 1 22 PRO n 1 23 PHE n 1 24 LEU n 1 25 GLU n 1 26 ALA n 1 27 VAL n 1 28 SER n 1 29 HIS n 1 30 LEU n 1 31 PRO n 1 32 PRO n 1 33 PHE n 1 34 PHE n 1 35 ASP n 1 36 CYS n 1 37 LEU n 1 38 GLY n 1 39 SER n 1 40 PRO n 1 41 VAL n 1 42 PHE n 1 43 THR n 1 44 PRO n 1 45 ILE n 1 46 LYS n 1 47 ALA n 1 48 ASP n 1 49 ILE n 1 50 SER n 1 51 GLY n 1 52 ASN n 1 53 ILE n 1 54 THR n 1 55 LYS n 1 56 ILE n 1 57 LYS n 1 58 ALA n 1 59 VAL n 1 60 TYR n 1 61 ASP n 1 62 THR n 1 63 ASN n 1 64 PRO n 1 65 ALA n 1 66 LYS n 1 67 PHE n 1 68 ARG n 1 69 THR n 1 70 LEU n 1 71 GLN n 1 72 ASN n 1 73 ILE n 1 74 LEU n 1 75 GLU n 1 76 VAL n 1 77 GLU n 1 78 LYS n 1 79 GLU n 1 80 MET n 1 81 TYR n 1 82 GLY n 1 83 ALA n 1 84 GLU n 1 85 TRP n 1 86 PRO n 1 87 LYS n 1 88 VAL n 1 89 GLY n 1 90 ALA n 1 91 THR n 1 92 LEU n 1 93 ALA n 1 94 LEU n 1 95 MET n 1 96 TRP n 1 97 LEU n 1 98 LYS n 1 99 ARG n 1 100 GLY n 1 101 LEU n 1 102 ARG n 1 103 PHE n 1 104 ILE n 1 105 GLN n 1 106 VAL n 1 107 PHE n 1 108 LEU n 1 109 GLN n 1 110 SER n 1 111 ILE n 1 112 CYS n 1 113 ASP n 1 114 GLY n 1 115 GLU n 1 116 ARG n 1 117 ASP n 1 118 GLU n 1 119 ASN n 1 120 HIS n 1 121 PRO n 1 122 ASN n 1 123 LEU n 1 124 ILE n 1 125 ARG n 1 126 VAL n 1 127 ASN n 1 128 ALA n 1 129 THR n 1 130 LYS n 1 131 ALA n 1 132 TYR n 1 133 GLU n 1 134 MET n 1 135 ALA n 1 136 LEU n 1 137 LYS n 1 138 LYS n 1 139 TYR n 1 140 HIS n 1 141 GLY n 1 142 TRP n 1 143 ILE n 1 144 VAL n 1 145 GLN n 1 146 LYS n 1 147 ILE n 1 148 PHE n 1 149 GLN n 1 150 ALA n 1 151 ALA n 1 152 LEU n 1 153 TYR n 1 154 ALA n 1 155 ALA n 1 156 PRO n 1 157 TYR n 1 158 LYS n 1 159 SER n 1 160 ASP n 1 161 PHE n 1 162 LEU n 1 163 LYS n 1 164 ALA n 1 165 LEU n 1 166 SER n 1 167 LYS n 1 168 GLY n 1 169 GLN n 1 170 ASN n 1 171 VAL n 1 172 THR n 1 173 GLU n 1 174 GLU n 1 175 GLU n 1 176 CYS n 1 177 LEU n 1 178 GLU n 1 179 LYS n 1 180 ILE n 1 181 ARG n 1 182 LEU n 1 183 PHE n 1 184 LEU n 1 185 VAL n 1 186 ASN n 1 187 TYR n 1 188 THR n 1 189 ALA n 1 190 THR n 1 191 ILE n 1 192 ASP n 1 193 VAL n 1 194 ILE n 1 195 TYR n 1 196 GLU n 1 197 MET n 1 198 TYR n 1 199 THR n 1 200 GLN n 1 201 MET n 1 202 ASN n 1 203 ALA n 1 204 GLU n 1 205 LEU n 1 206 ASN n 1 207 TYR n 1 208 LYS n 1 209 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene GLTP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLTP_HUMAN _struct_ref.pdbx_db_accession Q9NZD2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTLQNILEVEKEM YGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSD FLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV ; _struct_ref.pdbx_align_begin 0 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SX6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 209 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NZD2 _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 208 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 209 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BGC 'D-saccharide, beta linking' . beta-D-glucopyranose ? 'C6 H12 O6' 180.156 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GAL 'D-saccharide, beta linking' . beta-D-galactopyranose ? 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OCT non-polymer . N-OCTANE ? 'C8 H18' 114.229 OLA non-polymer . 'OLEIC ACID' ? 'C18 H34 O2' 282.461 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SPH non-polymer . SPHINGOSINE ? 'C18 H37 N O2' 299.492 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1SX6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 45.18 _exptl_crystal.description ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pdbx_details 'PEG 8000, potassium phosphate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS HTC' _diffrn_detector.pdbx_collection_date 2003-12-19 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH3R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1SX6 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 100. _reflns.number_all 16853 _reflns.number_obs 16786 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.117 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15. _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.33 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.9 _reflns_shell.d_res_low 1.97 _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs 0.49 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.7 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1672 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1SX6 _refine.ls_number_reflns_obs 14761 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I 0. _refine.pdbx_ls_sigma_F 0. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.95 _refine.ls_percent_reflns_obs 99.78 _refine.ls_R_factor_obs 0.19479 _refine.ls_R_factor_all 0.1947 _refine.ls_R_factor_R_work 0.19202 _refine.ls_R_factor_R_free 0.24429 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 785 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.966 _refine.correlation_coeff_Fo_to_Fc_free 0.949 _refine.B_iso_mean 38.691 _refine.aniso_B[1][1] -2.33 _refine.aniso_B[2][2] 1.27 _refine.aniso_B[3][3] 0.81 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.23 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 1SWX' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.194 _refine.pdbx_overall_ESU_R_Free 0.173 _refine.overall_SU_ML 0.158 _refine.overall_SU_B 6.124 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1645 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 70 _refine_hist.number_atoms_solvent 160 _refine_hist.number_atoms_total 1875 _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.011 0.022 ? 1758 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 1650 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.240 1.998 ? 2365 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.845 3.000 ? 3850 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.398 5.000 ? 203 'X-RAY DIFFRACTION' ? r_chiral_restr 0.071 0.200 ? 267 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.020 ? 1839 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.002 0.020 ? 335 'X-RAY DIFFRACTION' ? r_nbd_refined 0.198 0.200 ? 429 'X-RAY DIFFRACTION' ? r_nbd_other 0.218 0.200 ? 1922 'X-RAY DIFFRACTION' ? r_nbtor_other 0.088 0.200 ? 949 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.177 0.200 ? 109 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.263 0.200 ? 4 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.138 0.200 ? 25 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.376 0.200 ? 4 'X-RAY DIFFRACTION' ? r_mcbond_it 0.701 1.500 ? 1027 'X-RAY DIFFRACTION' ? r_mcangle_it 1.316 2.000 ? 1659 'X-RAY DIFFRACTION' ? r_scbond_it 1.821 3.000 ? 730 'X-RAY DIFFRACTION' ? r_scangle_it 3.135 4.500 ? 706 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.950 _refine_ls_shell.d_res_low 2.000 _refine_ls_shell.number_reflns_R_work 1070 _refine_ls_shell.R_factor_R_work 0.372 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.465 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 51 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1SX6 _struct.title 'Crystal structure of human Glycolipid Transfer protein in lactosylceramide-bound form' _struct.pdbx_descriptor 'Glycolipid transfer protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SX6 _struct_keywords.pdbx_keywords 'LIPID TRANSPORT' _struct_keywords.text 'glycosphingolipid transfer protein-lactosylceramide complex, LIPID TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 19 ? SER A 28 ? GLU A 19 SER A 28 1 ? 10 HELX_P HELX_P2 2 HIS A 29 ? LEU A 37 ? HIS A 29 LEU A 37 5 ? 9 HELX_P HELX_P3 3 SER A 39 ? VAL A 41 ? SER A 39 VAL A 41 5 ? 3 HELX_P HELX_P4 4 PHE A 42 ? ASN A 63 ? PHE A 42 ASN A 63 1 ? 22 HELX_P HELX_P5 5 THR A 69 ? GLY A 82 ? THR A 69 GLY A 82 1 ? 14 HELX_P HELX_P6 6 ALA A 83 ? TRP A 85 ? ALA A 83 TRP A 85 5 ? 3 HELX_P HELX_P7 7 VAL A 88 ? ASP A 113 ? VAL A 88 ASP A 113 1 ? 26 HELX_P HELX_P8 8 ILE A 124 ? LEU A 136 ? ILE A 124 LEU A 136 1 ? 13 HELX_P HELX_P9 9 LYS A 137 ? HIS A 140 ? LYS A 137 HIS A 140 5 ? 4 HELX_P HELX_P10 10 GLY A 141 ? LEU A 152 ? GLY A 141 LEU A 152 1 ? 12 HELX_P HELX_P11 11 TYR A 153 ? ALA A 155 ? TYR A 153 ALA A 155 5 ? 3 HELX_P HELX_P12 12 TYR A 157 ? SER A 166 ? TYR A 157 SER A 166 1 ? 10 HELX_P HELX_P13 13 THR A 172 ? MET A 201 ? THR A 172 MET A 201 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? C SPH . N2 ? ? ? 1_555 D OLA . C1 ? ? A SPH 301 A OLA 302 1_555 ? ? ? ? ? ? ? 1.275 ? ? covale2 covale none ? C SPH . C1 ? ? ? 1_555 B BGC . O1 ? ? A SPH 301 B BGC 1 1_555 ? ? ? ? ? ? ? 1.347 ? ? covale3 covale both ? B BGC . O4 ? ? ? 1_555 B GAL . C1 ? ? B BGC 1 B GAL 2 1_555 ? ? ? ? ? ? ? 1.406 sing ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TRP _struct_mon_prot_cis.label_seq_id 85 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TRP _struct_mon_prot_cis.auth_seq_id 85 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 86 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 86 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 6.62 # _database_PDB_matrix.entry_id 1SX6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1SX6 _atom_sites.fract_transf_matrix[1][1] 0.013228 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008434 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020378 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017304 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _database_PDB_caveat.id _database_PDB_caveat.text 1 'BGC B 1 HAS WRONG CHIRALITY AT ATOM C1' 2 'SPH A 301 HAS WRONG CHIRALITY AT ATOM C2' 3 'SPH A 301 HAS WRONG CHIRALITY AT ATOM C3' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 CYS 112 112 112 CYS CYS A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 TRP 142 142 142 TRP TRP A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 GLY 168 168 ? ? ? A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 CYS 176 176 176 CYS CYS A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 PHE 183 183 183 PHE PHE A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 ASN 186 186 186 ASN ASN A . n A 1 187 TYR 187 187 187 TYR TYR A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 TYR 195 195 195 TYR TYR A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 MET 197 197 197 MET MET A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 GLN 200 200 200 GLN GLN A . n A 1 201 MET 201 201 201 MET MET A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 ASN 206 206 206 ASN ASN A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 VAL 209 209 209 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SPH 1 301 301 SPH SPH A . D 4 OLA 1 302 302 OLA ACL A . E 5 OCT 1 303 303 OCT LMM A . F 6 HOH 1 304 1 HOH HOH A . F 6 HOH 2 305 2 HOH HOH A . F 6 HOH 3 306 3 HOH HOH A . F 6 HOH 4 307 4 HOH HOH A . F 6 HOH 5 308 5 HOH HOH A . F 6 HOH 6 309 6 HOH HOH A . F 6 HOH 7 310 7 HOH HOH A . F 6 HOH 8 311 8 HOH HOH A . F 6 HOH 9 312 9 HOH HOH A . F 6 HOH 10 313 10 HOH HOH A . F 6 HOH 11 314 11 HOH HOH A . F 6 HOH 12 315 12 HOH HOH A . F 6 HOH 13 316 13 HOH HOH A . F 6 HOH 14 317 14 HOH HOH A . F 6 HOH 15 318 15 HOH HOH A . F 6 HOH 16 319 16 HOH HOH A . F 6 HOH 17 320 17 HOH HOH A . F 6 HOH 18 321 18 HOH HOH A . F 6 HOH 19 322 19 HOH HOH A . F 6 HOH 20 323 20 HOH HOH A . F 6 HOH 21 324 21 HOH HOH A . F 6 HOH 22 325 22 HOH HOH A . F 6 HOH 23 326 23 HOH HOH A . F 6 HOH 24 327 24 HOH HOH A . F 6 HOH 25 328 25 HOH HOH A . F 6 HOH 26 329 26 HOH HOH A . F 6 HOH 27 330 27 HOH HOH A . F 6 HOH 28 331 28 HOH HOH A . F 6 HOH 29 332 29 HOH HOH A . F 6 HOH 30 333 30 HOH HOH A . F 6 HOH 31 334 31 HOH HOH A . F 6 HOH 32 335 32 HOH HOH A . F 6 HOH 33 336 33 HOH HOH A . F 6 HOH 34 337 34 HOH HOH A . F 6 HOH 35 338 35 HOH HOH A . F 6 HOH 36 339 36 HOH HOH A . F 6 HOH 37 340 37 HOH HOH A . F 6 HOH 38 341 38 HOH HOH A . F 6 HOH 39 342 39 HOH HOH A . F 6 HOH 40 343 40 HOH HOH A . F 6 HOH 41 344 41 HOH HOH A . F 6 HOH 42 345 42 HOH HOH A . F 6 HOH 43 346 43 HOH HOH A . F 6 HOH 44 347 44 HOH HOH A . F 6 HOH 45 348 45 HOH HOH A . F 6 HOH 46 349 46 HOH HOH A . F 6 HOH 47 350 47 HOH HOH A . F 6 HOH 48 351 48 HOH HOH A . F 6 HOH 49 352 49 HOH HOH A . F 6 HOH 50 353 50 HOH HOH A . F 6 HOH 51 354 51 HOH HOH A . F 6 HOH 52 355 52 HOH HOH A . F 6 HOH 53 356 53 HOH HOH A . F 6 HOH 54 357 54 HOH HOH A . F 6 HOH 55 358 55 HOH HOH A . F 6 HOH 56 359 56 HOH HOH A . F 6 HOH 57 360 57 HOH HOH A . F 6 HOH 58 361 59 HOH HOH A . F 6 HOH 59 362 61 HOH HOH A . F 6 HOH 60 363 62 HOH HOH A . F 6 HOH 61 364 63 HOH HOH A . F 6 HOH 62 365 64 HOH HOH A . F 6 HOH 63 366 65 HOH HOH A . F 6 HOH 64 367 66 HOH HOH A . F 6 HOH 65 368 67 HOH HOH A . F 6 HOH 66 369 68 HOH HOH A . F 6 HOH 67 370 69 HOH HOH A . F 6 HOH 68 371 70 HOH HOH A . F 6 HOH 69 372 72 HOH HOH A . F 6 HOH 70 373 73 HOH HOH A . F 6 HOH 71 374 74 HOH HOH A . F 6 HOH 72 375 76 HOH HOH A . F 6 HOH 73 376 77 HOH HOH A . F 6 HOH 74 377 78 HOH HOH A . F 6 HOH 75 378 79 HOH HOH A . F 6 HOH 76 379 80 HOH HOH A . F 6 HOH 77 380 81 HOH HOH A . F 6 HOH 78 381 82 HOH HOH A . F 6 HOH 79 382 83 HOH HOH A . F 6 HOH 80 383 84 HOH HOH A . F 6 HOH 81 384 85 HOH HOH A . F 6 HOH 82 385 86 HOH HOH A . F 6 HOH 83 386 87 HOH HOH A . F 6 HOH 84 387 88 HOH HOH A . F 6 HOH 85 388 90 HOH HOH A . F 6 HOH 86 389 91 HOH HOH A . F 6 HOH 87 390 92 HOH HOH A . F 6 HOH 88 391 93 HOH HOH A . F 6 HOH 89 392 94 HOH HOH A . F 6 HOH 90 393 95 HOH HOH A . F 6 HOH 91 394 96 HOH HOH A . F 6 HOH 92 395 98 HOH HOH A . F 6 HOH 93 396 101 HOH HOH A . F 6 HOH 94 397 102 HOH HOH A . F 6 HOH 95 398 103 HOH HOH A . F 6 HOH 96 399 105 HOH HOH A . F 6 HOH 97 400 106 HOH HOH A . F 6 HOH 98 401 107 HOH HOH A . F 6 HOH 99 402 108 HOH HOH A . F 6 HOH 100 403 109 HOH HOH A . F 6 HOH 101 404 110 HOH HOH A . F 6 HOH 102 405 111 HOH HOH A . F 6 HOH 103 406 112 HOH HOH A . F 6 HOH 104 407 113 HOH HOH A . F 6 HOH 105 408 115 HOH HOH A . F 6 HOH 106 409 116 HOH HOH A . F 6 HOH 107 410 117 HOH HOH A . F 6 HOH 108 411 118 HOH HOH A . F 6 HOH 109 412 119 HOH HOH A . F 6 HOH 110 413 120 HOH HOH A . F 6 HOH 111 414 121 HOH HOH A . F 6 HOH 112 415 122 HOH HOH A . F 6 HOH 113 416 124 HOH HOH A . F 6 HOH 114 417 125 HOH HOH A . F 6 HOH 115 418 126 HOH HOH A . F 6 HOH 116 419 128 HOH HOH A . F 6 HOH 117 420 129 HOH HOH A . F 6 HOH 118 421 131 HOH HOH A . F 6 HOH 119 422 132 HOH HOH A . F 6 HOH 120 423 133 HOH HOH A . F 6 HOH 121 424 134 HOH HOH A . F 6 HOH 122 425 135 HOH HOH A . F 6 HOH 123 426 136 HOH HOH A . F 6 HOH 124 427 137 HOH HOH A . F 6 HOH 125 428 138 HOH HOH A . F 6 HOH 126 429 140 HOH HOH A . F 6 HOH 127 430 142 HOH HOH A . F 6 HOH 128 431 143 HOH HOH A . F 6 HOH 129 432 144 HOH HOH A . F 6 HOH 130 433 145 HOH HOH A . F 6 HOH 131 434 146 HOH HOH A . F 6 HOH 132 435 148 HOH HOH A . F 6 HOH 133 436 149 HOH HOH A . F 6 HOH 134 437 150 HOH HOH A . F 6 HOH 135 438 151 HOH HOH A . F 6 HOH 136 439 152 HOH HOH A . F 6 HOH 137 440 153 HOH HOH A . F 6 HOH 138 441 154 HOH HOH A . F 6 HOH 139 442 155 HOH HOH A . F 6 HOH 140 443 157 HOH HOH A . F 6 HOH 141 444 159 HOH HOH A . F 6 HOH 142 445 160 HOH HOH A . F 6 HOH 143 446 162 HOH HOH A . F 6 HOH 144 447 166 HOH HOH A . F 6 HOH 145 448 167 HOH HOH A . F 6 HOH 146 449 168 HOH HOH A . F 6 HOH 147 450 169 HOH HOH A . F 6 HOH 148 451 170 HOH HOH A . F 6 HOH 149 452 171 HOH HOH A . F 6 HOH 150 453 172 HOH HOH A . F 6 HOH 151 454 173 HOH HOH A . F 6 HOH 152 455 174 HOH HOH A . F 6 HOH 153 456 175 HOH HOH A . F 6 HOH 154 457 176 HOH HOH A . F 6 HOH 155 458 177 HOH HOH A . F 6 HOH 156 459 178 HOH HOH A . F 6 HOH 157 460 180 HOH HOH A . F 6 HOH 158 461 181 HOH HOH A . F 6 HOH 159 462 182 HOH HOH A . F 6 HOH 160 463 183 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_900004 _pdbx_molecule_features.name beta-lactose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Nutrient _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900004 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 319 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-31 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Atomic model' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Non-polymer description' 9 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' database_PDB_caveat 4 4 'Structure model' entity 5 4 'Structure model' entity_name_com 6 4 'Structure model' pdbx_branch_scheme 7 4 'Structure model' pdbx_chem_comp_identifier 8 4 'Structure model' pdbx_entity_branch 9 4 'Structure model' pdbx_entity_branch_descriptor 10 4 'Structure model' pdbx_entity_branch_link 11 4 'Structure model' pdbx_entity_branch_list 12 4 'Structure model' pdbx_entity_nonpoly 13 4 'Structure model' pdbx_molecule_features 14 4 'Structure model' pdbx_nonpoly_scheme 15 4 'Structure model' pdbx_validate_chiral 16 4 'Structure model' struct_conn 17 4 'Structure model' struct_site 18 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_atom_site.auth_asym_id' 6 4 'Structure model' '_atom_site.auth_atom_id' 7 4 'Structure model' '_atom_site.auth_comp_id' 8 4 'Structure model' '_atom_site.auth_seq_id' 9 4 'Structure model' '_atom_site.label_atom_id' 10 4 'Structure model' '_atom_site.label_comp_id' 11 4 'Structure model' '_chem_comp.formula' 12 4 'Structure model' '_chem_comp.formula_weight' 13 4 'Structure model' '_chem_comp.id' 14 4 'Structure model' '_chem_comp.mon_nstd_flag' 15 4 'Structure model' '_chem_comp.name' 16 4 'Structure model' '_chem_comp.type' 17 4 'Structure model' '_entity.formula_weight' 18 4 'Structure model' '_entity.pdbx_description' 19 4 'Structure model' '_entity.type' 20 4 'Structure model' '_pdbx_validate_chiral.auth_asym_id' 21 4 'Structure model' '_pdbx_validate_chiral.auth_atom_id' 22 4 'Structure model' '_pdbx_validate_chiral.auth_comp_id' 23 4 'Structure model' '_pdbx_validate_chiral.auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 CrystalClear 'data reduction' '(MSC/RIGAKU)' ? 2 SCALEPACK 'data scaling' . ? 3 AMoRE phasing . ? 4 # _pdbx_database_remark.id 600 _pdbx_database_remark.text ;heterogen The residues LAT, SPH and OLA together form a lactosylceramide. The atom O in SPH and O1 in OLA are lost during the formation of this ligand. ; # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 ND2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 206 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 456 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 102 ? ? CZ A ARG 102 ? A NH2 A ARG 102 ? A 124.31 120.30 4.01 0.50 N 2 1 NE A ARG 102 ? ? CZ A ARG 102 ? B NH2 A ARG 102 ? B 124.59 120.30 4.29 0.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 63 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -161.27 _pdbx_validate_torsion.psi 81.88 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 C1 ? B BGC 1 ? 'WRONG HAND' . 2 1 C2 ? A SPH 301 ? 'WRONG HAND' . 3 1 C3 ? A SPH 301 ? 'WRONG HAND' . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 167 ? CG ? A LYS 167 CG 2 1 Y 1 A LYS 167 ? CD ? A LYS 167 CD 3 1 Y 1 A LYS 167 ? CE ? A LYS 167 CE 4 1 Y 1 A LYS 167 ? NZ ? A LYS 167 NZ 5 1 Y 1 A GLN 169 ? CG ? A GLN 169 CG 6 1 Y 1 A GLN 169 ? CD ? A GLN 169 CD 7 1 Y 1 A GLN 169 ? OE1 ? A GLN 169 OE1 8 1 Y 1 A GLN 169 ? NE2 ? A GLN 169 NE2 9 1 Y 1 A ASN 170 ? CG ? A ASN 170 CG 10 1 Y 1 A ASN 170 ? OD1 ? A ASN 170 OD1 11 1 Y 1 A ASN 170 ? ND2 ? A ASN 170 ND2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A GLY 168 ? A GLY 168 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 BGC 1 B BGC 1 B LAT 300 n B 2 GAL 2 B GAL 2 B LAT 300 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpb BGC 'COMMON NAME' GMML 1.0 b-D-glucopyranose BGC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Glcp BGC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGalpb1-4DGlcpb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5][a2112h-1b_1-5]/1-2/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][a-D-Glcp]{[(4+1)][b-D-Galp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 GAL _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 BGC _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 BGC 1 n 2 GAL 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 SPHINGOSINE SPH 4 'OLEIC ACID' OLA 5 N-OCTANE OCT 6 water HOH #